Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   ACEZ45_RS01950 Genome accession   NZ_CP169877
Coordinates   380564..380683 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain JF     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 375564..385683
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACEZ45_RS01935 (ACEZ45_01935) - 377176..377859 (+) 684 WP_103695313.1 response regulator transcription factor -
  ACEZ45_RS01940 (ACEZ45_01940) - 377846..379279 (+) 1434 WP_161503399.1 HAMP domain-containing sensor histidine kinase -
  ACEZ45_RS01945 (ACEZ45_01945) rapC 379432..380580 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  ACEZ45_RS01950 (ACEZ45_01950) phrC 380564..380683 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACEZ45_RS01955 (ACEZ45_01955) - 380833..380943 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACEZ45_RS01960 (ACEZ45_01960) - 381023..382387 (-) 1365 WP_014304341.1 aspartate kinase -
  ACEZ45_RS01965 (ACEZ45_01965) ceuB 382802..383755 (+) 954 WP_046559346.1 ABC transporter permease Machinery gene
  ACEZ45_RS01970 (ACEZ45_01970) - 383745..384692 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  ACEZ45_RS01975 (ACEZ45_01975) - 384686..385444 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1053945 ACEZ45_RS01950 WP_003156334.1 380564..380683(+) (phrC) [Bacillus amyloliquefaciens strain JF]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1053945 ACEZ45_RS01950 WP_003156334.1 380564..380683(+) (phrC) [Bacillus amyloliquefaciens strain JF]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment