Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   ACEPM6_RS18820 Genome accession   NZ_CP169570
Coordinates   3757365..3757484 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain CIMT3     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3752365..3762484
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACEPM6_RS18805 (ACEPM6_18805) - 3753977..3754660 (+) 684 WP_022552587.1 response regulator transcription factor -
  ACEPM6_RS18810 (ACEPM6_18810) - 3754647..3756074 (+) 1428 WP_089072406.1 HAMP domain-containing sensor histidine kinase -
  ACEPM6_RS18815 (ACEPM6_18815) rapC 3756233..3757381 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  ACEPM6_RS18820 (ACEPM6_18820) phrC 3757365..3757484 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACEPM6_RS18825 (ACEPM6_18825) - 3757636..3757746 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  ACEPM6_RS18830 (ACEPM6_18830) - 3757826..3759190 (-) 1365 WP_021495117.1 aspartate kinase -
  ACEPM6_RS18835 (ACEPM6_18835) ceuB 3759604..3760557 (+) 954 WP_014416904.1 ABC transporter permease Machinery gene
  ACEPM6_RS18840 (ACEPM6_18840) - 3760547..3761494 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  ACEPM6_RS18845 (ACEPM6_18845) - 3761488..3762246 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1052364 ACEPM6_RS18820 WP_003156334.1 3757365..3757484(+) (phrC) [Bacillus velezensis strain CIMT3]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1052364 ACEPM6_RS18820 WP_003156334.1 3757365..3757484(+) (phrC) [Bacillus velezensis strain CIMT3]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment