Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   ACE01L_RS01275 Genome accession   NZ_CP169515
Coordinates   258781..259386 (+) Length   201 a.a.
NCBI ID   WP_001202375.1    Uniprot ID   A0A5I0N148
Organism   Salmonella enterica subsp. enterica serovar Infantis strain FSIS4900     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 225180..267646 258781..259386 within 0


Gene organization within MGE regions


Location: 225180..267646
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACE01L_RS01145 (ACE01L_01145) ldtD 225220..227067 (+) 1848 WP_000925896.1 L,D-transpeptidase -
  ACE01L_RS01150 (ACE01L_01150) - 227327..227875 (+) 549 WP_000357052.1 YcbK family protein -
  ACE01L_RS01155 (ACE01L_01155) - 227903..228550 (+) 648 WP_001109471.1 MBL fold metallo-hydrolase -
  ACE01L_RS01160 (ACE01L_01160) - 228648..229903 (+) 1256 WP_086016038.1 IS3-like element ISSen1 family transposase -
  ACE01L_RS01165 (ACE01L_01165) aspC 229927..231117 (-) 1191 WP_000462653.1 aspartate transaminase -
  ACE01L_RS01170 (ACE01L_01170) ompF 231302..232393 (-) 1092 WP_000977709.1 porin OmpF -
  ACE01L_RS01175 (ACE01L_01175) asnS 233000..234400 (-) 1401 WP_023993514.1 asparagine--tRNA ligase -
  ACE01L_RS01180 (ACE01L_01180) - 234601..235062 (-) 462 WP_000762342.1 Lrp/AsnC family transcriptional regulator -
  ACE01L_RS01185 (ACE01L_01185) dpaL 235379..236593 (+) 1215 WP_020438006.1 diaminopropionate ammonia-lyase -
  ACE01L_RS01190 (ACE01L_01190) - 236839..238272 (+) 1434 WP_000893191.1 sodium:alanine symporter family protein -
  ACE01L_RS01195 (ACE01L_01195) pncB 238353..239555 (-) 1203 WP_023993513.1 nicotinate phosphoribosyltransferase -
  ACE01L_RS01200 (ACE01L_01200) pepN 239822..242434 (+) 2613 WP_023993512.1 aminopeptidase N -
  ACE01L_RS01205 (ACE01L_01205) pyrD 242642..243652 (+) 1011 WP_000291723.1 quinone-dependent dihydroorotate dehydrogenase -
  ACE01L_RS01210 (ACE01L_01210) zapC 243818..244360 (+) 543 WP_023993511.1 cell division protein ZapC -
  ACE01L_RS01215 (ACE01L_01215) - 244357..245466 (-) 1110 WP_023993510.1 YcbX family protein -
  ACE01L_RS01220 (ACE01L_01220) rlmKL 245565..247673 (+) 2109 WP_023993509.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  ACE01L_RS01225 (ACE01L_01225) - 247686..249593 (+) 1908 WP_023993508.1 ABC transporter ATP-binding protein -
  ACE01L_RS01230 (ACE01L_01230) pqiA 249608..250861 (+) 1254 WP_000333152.1 membrane integrity-associated transporter subunit PqiA -
  ACE01L_RS01235 (ACE01L_01235) pqiB 250866..252506 (+) 1641 WP_000433414.1 intermembrane transport protein PqiB -
  ACE01L_RS01240 (ACE01L_01240) pqiC 252503..253066 (+) 564 WP_000759136.1 membrane integrity-associated transporter subunit PqiC -
  ACE01L_RS01245 (ACE01L_01245) rmf 253322..253489 (+) 168 WP_001537784.1 ribosome modulation factor -
  ACE01L_RS01250 (ACE01L_01250) fabA 253589..254107 (-) 519 WP_000227928.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  ACE01L_RS01255 (ACE01L_01255) - 254176..255936 (-) 1761 WP_000156457.1 Lon protease family protein -
  ACE01L_RS01260 (ACE01L_01260) matP 256122..256574 (+) 453 WP_000877172.1 macrodomain Ter protein MatP -
  ACE01L_RS01265 (ACE01L_01265) ompA 256646..257698 (-) 1053 WP_001670727.1 porin OmpA -
  ACE01L_RS01270 (ACE01L_01270) sulA 258055..258564 (-) 510 WP_000288732.1 SOS-induced cell division inhibitor SulA -
  ACE01L_RS01275 (ACE01L_01275) sxy/tfoX 258781..259386 (+) 606 WP_001202375.1 TfoX/Sxy family DNA transformation protein Regulator
  ACE01L_RS01280 (ACE01L_01280) yccS 259373..261526 (-) 2154 WP_000950876.1 YccS family putative transporter -
  ACE01L_RS01285 (ACE01L_01285) - 261545..261991 (-) 447 WP_023993507.1 YccF domain-containing protein -
  ACE01L_RS01290 (ACE01L_01290) helD 262115..264169 (+) 2055 WP_023993506.1 DNA helicase IV -
  ACE01L_RS01295 (ACE01L_01295) mgsA 264205..264663 (-) 459 WP_374986293.1 methylglyoxal synthase -
  ACE01L_RS01300 (ACE01L_01300) - 264758..265420 (-) 663 WP_000847719.1 DUF2057 family protein -
  ACE01L_RS01305 (ACE01L_01305) - 265594..266007 (+) 414 WP_001537782.1 CoA-binding protein -
  ACE01L_RS01310 (ACE01L_01310) hspQ 266052..266369 (-) 318 WP_000561983.1 heat shock protein HspQ -
  ACE01L_RS01315 (ACE01L_01315) rlmI 266427..267638 (-) 1212 WP_000140480.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -

Sequence


Protein


Download         Length: 201 a.a.        Molecular weight: 23174.94 Da        Isoelectric Point: 8.7403

>NTDB_id=1051568 ACE01L_RS01275 WP_001202375.1 258781..259386(+) (sxy/tfoX) [Salmonella enterica subsp. enterica serovar Infantis strain FSIS4900]
MRALSYDRIYKSQEYLASLGTIQYRSLFGSYSLTVEDTVFAMVANGELYLRACEESVPYCVKHPPAWLMFMKCGRPVMLN
YYRVDESLWRDQQQLVRLSKYSLDAAMKEKHSRILQHRLKDLPNMTFHLETLLNESGIKDENMLRILGAKMCWLRLRQSN
PLLTVKVLYALEGAIVGVHEAALPASRRQELADWAHSLTAG

Nucleotide


Download         Length: 606 bp        

>NTDB_id=1051568 ACE01L_RS01275 WP_001202375.1 258781..259386(+) (sxy/tfoX) [Salmonella enterica subsp. enterica serovar Infantis strain FSIS4900]
ATGAGAGCACTCTCTTATGACAGGATCTATAAATCGCAAGAATATTTGGCCTCTTTGGGGACGATCCAGTATCGATCTTT
ATTCGGTAGCTATAGTCTGACCGTGGAGGATACCGTCTTTGCGATGGTGGCTAATGGCGAGCTTTATCTCCGCGCCTGTG
AAGAAAGCGTACCCTACTGTGTGAAGCATCCTCCCGCCTGGCTCATGTTTATGAAATGTGGACGTCCCGTTATGCTCAAC
TATTACCGGGTGGATGAAAGCCTGTGGCGCGATCAGCAGCAGCTGGTGCGTTTATCGAAGTATTCTCTTGACGCGGCAAT
GAAGGAAAAACACAGCCGTATTTTACAGCACAGACTCAAAGATCTCCCCAATATGACCTTCCATCTGGAAACATTGCTCA
ATGAGTCAGGGATAAAGGACGAAAATATGTTACGCATACTGGGCGCGAAAATGTGCTGGCTAAGGTTGCGACAAAGCAAT
CCCTTGCTGACGGTGAAAGTTTTGTATGCCCTGGAAGGCGCAATTGTCGGCGTACATGAAGCGGCGCTCCCGGCGAGTCG
TCGCCAGGAGCTTGCCGACTGGGCTCATTCGCTTACGGCTGGGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5I0N148

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

75.879

99.005

0.751


Multiple sequence alignment