Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   ACE01K_RS09505 Genome accession   NZ_CP169501
Coordinates   1978842..1979447 (+) Length   201 a.a.
NCBI ID   WP_001202375.1    Uniprot ID   A0A5I0N148
Organism   Salmonella enterica subsp. enterica serovar Infantis strain FSIS7821     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1945242..1987707 1978842..1979447 within 0


Gene organization within MGE regions


Location: 1945242..1987707
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACE01K_RS09375 (ACE01K_09375) ldtD 1945282..1947129 (+) 1848 WP_000925896.1 L,D-transpeptidase -
  ACE01K_RS09380 (ACE01K_09380) - 1947389..1947937 (+) 549 WP_000357052.1 YcbK family protein -
  ACE01K_RS09385 (ACE01K_09385) - 1947965..1948612 (+) 648 WP_001109471.1 MBL fold metallo-hydrolase -
  ACE01K_RS09390 (ACE01K_09390) - 1948710..1949965 (+) 1256 WP_086016038.1 IS3-like element ISSen1 family transposase -
  ACE01K_RS09395 (ACE01K_09395) aspC 1949989..1951179 (-) 1191 WP_000462653.1 aspartate transaminase -
  ACE01K_RS09400 (ACE01K_09400) ompF 1951363..1952454 (-) 1092 WP_000977709.1 porin OmpF -
  ACE01K_RS09405 (ACE01K_09405) asnS 1953061..1954461 (-) 1401 WP_023993514.1 asparagine--tRNA ligase -
  ACE01K_RS09410 (ACE01K_09410) - 1954662..1955123 (-) 462 WP_000762342.1 Lrp/AsnC family transcriptional regulator -
  ACE01K_RS09415 (ACE01K_09415) dpaL 1955440..1956654 (+) 1215 WP_020438006.1 diaminopropionate ammonia-lyase -
  ACE01K_RS09420 (ACE01K_09420) - 1956900..1958333 (+) 1434 WP_000893191.1 sodium:alanine symporter family protein -
  ACE01K_RS09425 (ACE01K_09425) pncB 1958414..1959616 (-) 1203 WP_023993513.1 nicotinate phosphoribosyltransferase -
  ACE01K_RS09430 (ACE01K_09430) pepN 1959883..1962495 (+) 2613 WP_023993512.1 aminopeptidase N -
  ACE01K_RS09435 (ACE01K_09435) pyrD 1962703..1963713 (+) 1011 WP_000291723.1 quinone-dependent dihydroorotate dehydrogenase -
  ACE01K_RS09440 (ACE01K_09440) zapC 1963879..1964421 (+) 543 WP_023993511.1 cell division protein ZapC -
  ACE01K_RS09445 (ACE01K_09445) - 1964418..1965527 (-) 1110 WP_023993510.1 YcbX family protein -
  ACE01K_RS09450 (ACE01K_09450) rlmKL 1965626..1967734 (+) 2109 WP_374987363.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  ACE01K_RS09455 (ACE01K_09455) - 1967747..1969654 (+) 1908 WP_023993508.1 ABC transporter ATP-binding protein -
  ACE01K_RS09460 (ACE01K_09460) pqiA 1969669..1970922 (+) 1254 WP_000333152.1 membrane integrity-associated transporter subunit PqiA -
  ACE01K_RS09465 (ACE01K_09465) pqiB 1970927..1972567 (+) 1641 WP_374987624.1 intermembrane transport protein PqiB -
  ACE01K_RS09470 (ACE01K_09470) pqiC 1972564..1973127 (+) 564 WP_000759136.1 membrane integrity-associated transporter subunit PqiC -
  ACE01K_RS09475 (ACE01K_09475) rmf 1973383..1973550 (+) 168 WP_001537784.1 ribosome modulation factor -
  ACE01K_RS09480 (ACE01K_09480) fabA 1973650..1974168 (-) 519 WP_000227928.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  ACE01K_RS09485 (ACE01K_09485) - 1974237..1975997 (-) 1761 WP_000156457.1 Lon protease family protein -
  ACE01K_RS09490 (ACE01K_09490) matP 1976183..1976635 (+) 453 WP_000877172.1 macrodomain Ter protein MatP -
  ACE01K_RS09495 (ACE01K_09495) ompA 1976707..1977759 (-) 1053 WP_001670727.1 porin OmpA -
  ACE01K_RS09500 (ACE01K_09500) sulA 1978116..1978625 (-) 510 WP_000288732.1 SOS-induced cell division inhibitor SulA -
  ACE01K_RS09505 (ACE01K_09505) sxy/tfoX 1978842..1979447 (+) 606 WP_001202375.1 TfoX/Sxy family DNA transformation protein Regulator
  ACE01K_RS09510 (ACE01K_09510) yccS 1979434..1981587 (-) 2154 WP_000950876.1 YccS family putative transporter -
  ACE01K_RS09515 (ACE01K_09515) - 1981606..1982052 (-) 447 WP_023993507.1 YccF domain-containing protein -
  ACE01K_RS09520 (ACE01K_09520) helD 1982176..1984230 (+) 2055 WP_023993506.1 DNA helicase IV -
  ACE01K_RS09525 (ACE01K_09525) mgsA 1984266..1984724 (-) 459 WP_023993505.1 methylglyoxal synthase -
  ACE01K_RS09530 (ACE01K_09530) - 1984819..1985481 (-) 663 WP_000847719.1 DUF2057 family protein -
  ACE01K_RS09535 (ACE01K_09535) - 1985655..1986068 (+) 414 WP_001537782.1 CoA-binding protein -
  ACE01K_RS09540 (ACE01K_09540) hspQ 1986113..1986430 (-) 318 WP_000561983.1 heat shock protein HspQ -
  ACE01K_RS09545 (ACE01K_09545) rlmI 1986488..1987699 (-) 1212 WP_374987364.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -

Sequence


Protein


Download         Length: 201 a.a.        Molecular weight: 23174.94 Da        Isoelectric Point: 8.7403

>NTDB_id=1051431 ACE01K_RS09505 WP_001202375.1 1978842..1979447(+) (sxy/tfoX) [Salmonella enterica subsp. enterica serovar Infantis strain FSIS7821]
MRALSYDRIYKSQEYLASLGTIQYRSLFGSYSLTVEDTVFAMVANGELYLRACEESVPYCVKHPPAWLMFMKCGRPVMLN
YYRVDESLWRDQQQLVRLSKYSLDAAMKEKHSRILQHRLKDLPNMTFHLETLLNESGIKDENMLRILGAKMCWLRLRQSN
PLLTVKVLYALEGAIVGVHEAALPASRRQELADWAHSLTAG

Nucleotide


Download         Length: 606 bp        

>NTDB_id=1051431 ACE01K_RS09505 WP_001202375.1 1978842..1979447(+) (sxy/tfoX) [Salmonella enterica subsp. enterica serovar Infantis strain FSIS7821]
ATGAGAGCACTCTCTTATGACAGGATCTATAAATCGCAAGAATATTTGGCCTCTTTGGGGACGATCCAGTATCGATCTTT
ATTCGGTAGCTATAGTCTGACCGTGGAGGATACCGTCTTTGCGATGGTGGCTAATGGCGAGCTTTATCTCCGCGCCTGTG
AAGAAAGCGTACCCTACTGTGTGAAGCATCCTCCCGCCTGGCTCATGTTTATGAAATGTGGACGTCCCGTTATGCTCAAC
TATTACCGGGTGGATGAAAGCCTGTGGCGCGATCAGCAGCAGCTGGTGCGTTTATCGAAGTATTCTCTTGACGCGGCAAT
GAAGGAAAAACACAGCCGTATTTTACAGCACAGACTCAAAGATCTCCCCAATATGACCTTCCATCTGGAAACATTGCTCA
ATGAGTCAGGGATAAAGGACGAAAATATGTTACGCATACTGGGCGCGAAAATGTGCTGGCTAAGGTTGCGACAAAGCAAT
CCCTTGCTGACGGTGAAAGTTTTGTATGCCCTGGAAGGCGCAATTGTCGGCGTACATGAAGCGGCGCTCCCGGCGAGTCG
TCGCCAGGAGCTTGCCGACTGGGCTCATTCGCTTACGGCTGGGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5I0N148

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

75.879

99.005

0.751


Multiple sequence alignment