Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   ACET1L_RS13545 Genome accession   NZ_CP169023
Coordinates   2551899..2552483 (-) Length   194 a.a.
NCBI ID   WP_077825616.1    Uniprot ID   -
Organism   Escherichia coli strain UTME-6     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2530008..2568738 2551899..2552483 within 0


Gene organization within MGE regions


Location: 2530008..2568738
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACET1L_RS13390 (ACET1L_13390) - 2530070..2530333 (-) 264 WP_000224233.1 hypothetical protein -
  ACET1L_RS13395 (ACET1L_13395) - 2530335..2530552 (-) 218 Protein_2618 DUF4014 family protein -
  ACET1L_RS13400 (ACET1L_13400) - 2530585..2530797 (-) 213 WP_000935420.1 hypothetical protein -
  ACET1L_RS13405 (ACET1L_13405) - 2530848..2531204 (-) 357 WP_000403777.1 hypothetical protein -
  ACET1L_RS13410 (ACET1L_13410) - 2531182..2531643 (-) 462 WP_001209481.1 sigma-E factor regulatory protein RseB domain-containing protein -
  ACET1L_RS13415 (ACET1L_13415) - 2531640..2531936 (-) 297 WP_001266135.1 DUF4406 domain-containing protein -
  ACET1L_RS13420 (ACET1L_13420) - 2531933..2532355 (-) 423 WP_001151153.1 DUF977 family protein -
  ACET1L_RS13425 (ACET1L_13425) - 2532396..2533466 (-) 1071 WP_001262389.1 hypothetical protein -
  ACET1L_RS13430 (ACET1L_13430) - 2533538..2533963 (-) 426 WP_000693949.1 toxin YdaT family protein -
  ACET1L_RS13435 (ACET1L_13435) - 2533960..2534175 (-) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  ACET1L_RS13440 (ACET1L_13440) - 2534225..2534941 (+) 717 WP_000103686.1 LexA family transcriptional regulator -
  ACET1L_RS13445 (ACET1L_13445) - 2535214..2535366 (+) 153 WP_000379580.1 DUF1391 family protein -
  ACET1L_RS13450 (ACET1L_13450) - 2535378..2535752 (+) 375 WP_000394557.1 hypothetical protein -
  ACET1L_RS13455 (ACET1L_13455) dicB 2536284..2536472 (+) 189 WP_000449192.1 cell division inhibition protein DicB -
  ACET1L_RS13460 (ACET1L_13460) - 2536469..2536660 (+) 192 WP_001090200.1 DUF1482 family protein -
  ACET1L_RS13465 (ACET1L_13465) - 2536753..2538174 (+) 1422 Protein_2632 exonuclease -
  ACET1L_RS13470 (ACET1L_13470) - 2538229..2539442 (+) 1214 WP_171877072.1 IS3-like element IS1203 family transposase -
  ACET1L_RS13475 (ACET1L_13475) - 2539485..2540537 (+) 1053 Protein_2634 3'-5' exoribonuclease domain-containing protein -
  ACET1L_RS13480 (ACET1L_13480) - 2540605..2540847 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  ACET1L_RS13485 (ACET1L_13485) - 2540825..2541840 (+) 1016 Protein_2636 tyrosine-type recombinase/integrase -
  ACET1L_RS13490 (ACET1L_13490) yccA 2542248..2542907 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  ACET1L_RS13495 (ACET1L_13495) tusE 2542998..2543327 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  ACET1L_RS13500 (ACET1L_13500) yccX 2543324..2543602 (-) 279 WP_000048244.1 acylphosphatase -
  ACET1L_RS13505 (ACET1L_13505) rlmI 2543697..2544887 (+) 1191 WP_000116302.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  ACET1L_RS13510 (ACET1L_13510) hspQ 2544945..2545262 (+) 318 WP_001295356.1 heat shock protein HspQ -
  ACET1L_RS13515 (ACET1L_13515) yccU 2545307..2545720 (-) 414 WP_000665217.1 CoA-binding protein -
  ACET1L_RS13520 (ACET1L_13520) yccT 2545893..2546555 (+) 663 WP_000847791.1 DUF2057 family protein -
  ACET1L_RS13525 (ACET1L_13525) mgsA 2546651..2547109 (+) 459 WP_000424181.1 methylglyoxal synthase -
  ACET1L_RS13530 (ACET1L_13530) helD 2547141..2549195 (-) 2055 WP_001297106.1 DNA helicase IV -
  ACET1L_RS13535 (ACET1L_13535) yccF 2549318..2549764 (+) 447 WP_001261235.1 YccF domain-containing protein -
  ACET1L_RS13540 (ACET1L_13540) yccS 2549774..2551936 (+) 2163 WP_000875023.1 YccS family putative transporter -
  ACET1L_RS13545 (ACET1L_13545) sxy/tfoX 2551899..2552483 (-) 585 WP_077825616.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  ACET1L_RS13550 (ACET1L_13550) sulA 2552747..2553256 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  ACET1L_RS13555 (ACET1L_13555) ompA 2553613..2554653 (+) 1041 WP_000750416.1 porin OmpA -
  ACET1L_RS13560 (ACET1L_13560) matP 2554729..2555181 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  ACET1L_RS13565 (ACET1L_13565) ycbZ 2555367..2557127 (+) 1761 WP_000156528.1 Lon protease family protein -
  ACET1L_RS13570 (ACET1L_13570) fabA 2557196..2557714 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  ACET1L_RS13575 (ACET1L_13575) rmf 2557784..2557951 (-) 168 WP_000828648.1 ribosome modulation factor -
  ACET1L_RS13580 (ACET1L_13580) pqiC 2558207..2558770 (-) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  ACET1L_RS13585 (ACET1L_13585) pqiB 2558767..2560407 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  ACET1L_RS13590 (ACET1L_13590) pqiA 2560412..2561665 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  ACET1L_RS13595 (ACET1L_13595) uup 2561795..2563702 (-) 1908 WP_000053122.1 ABC transporter ATP-binding protein -
  ACET1L_RS13600 (ACET1L_13600) rlmKL 2563714..2565822 (-) 2109 WP_001086519.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  ACET1L_RS13605 (ACET1L_13605) ycbX 2566066..2567175 (+) 1110 WP_000224312.1 6-N-hydroxylaminopurine resistance protein YcbX -
  ACET1L_RS13610 (ACET1L_13610) zapC 2567172..2567714 (-) 543 WP_001295353.1 cell division protein ZapC -

Sequence

Protein


Download         Length: 194 a.a.        Molecular weight: 22258.82 Da        Isoelectric Point: 8.4565

>NTDB_id=1049424 ACET1L_RS13545 WP_077825616.1 2551899..2552483(-) (sxy/tfoX) [Escherichia coli strain UTME-6]
MATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKL
VRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAI
IGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 585 bp        

>NTDB_id=1049424 ACET1L_RS13545 WP_077825616.1 2551899..2552483(-) (sxy/tfoX) [Escherichia coli strain UTME-6]
CTGGCAACGTTGGGCACAATTGAATACCGATCATTGTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGAT
GGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTGAGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGA
CATATAAAAAGTGTGGCCGATCCGTTACCCTCAATTACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTG
GTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCTGAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTT
GCCCAATATGTCTTTTCATCTGGAAGCGATTCTCGGGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGG
CAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATT
ATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACA
GGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX C-terminal domain (TfoX_C)

(101-179)

TfoX N-terminal domain (TfoX_N)

(2-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.485

100

0.995

Multiple sequence alignment