Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   ACET1B_RS18215 Genome accession   NZ_CP168991
Coordinates   3479988..3480572 (-) Length   194 a.a.
NCBI ID   WP_077825616.1    Uniprot ID   -
Organism   Escherichia coli strain UTAK-8     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3458105..3496827 3479988..3480572 within 0


Gene organization within MGE regions


Location: 3458105..3496827
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACET1B_RS18060 (ACET1B_18060) - 3458167..3458430 (-) 264 WP_000224233.1 hypothetical protein -
  ACET1B_RS18065 (ACET1B_18065) - 3458432..3458649 (-) 218 Protein_3537 DUF4014 family protein -
  ACET1B_RS18070 (ACET1B_18070) - 3458682..3458894 (-) 213 WP_000935420.1 hypothetical protein -
  ACET1B_RS18075 (ACET1B_18075) - 3458945..3459301 (-) 357 WP_000403777.1 hypothetical protein -
  ACET1B_RS18080 (ACET1B_18080) - 3459279..3459740 (-) 462 WP_001209481.1 sigma-E factor regulatory protein RseB domain-containing protein -
  ACET1B_RS18085 (ACET1B_18085) - 3459737..3460033 (-) 297 WP_001266135.1 DUF4406 domain-containing protein -
  ACET1B_RS18090 (ACET1B_18090) - 3460030..3460452 (-) 423 WP_001151153.1 DUF977 family protein -
  ACET1B_RS18095 (ACET1B_18095) - 3460493..3461563 (-) 1071 WP_001262389.1 hypothetical protein -
  ACET1B_RS18100 (ACET1B_18100) - 3461635..3462060 (-) 426 WP_000693949.1 toxin YdaT family protein -
  ACET1B_RS18105 (ACET1B_18105) - 3462057..3462272 (-) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  ACET1B_RS18110 (ACET1B_18110) - 3462322..3463038 (+) 717 WP_000103686.1 LexA family transcriptional regulator -
  ACET1B_RS18115 (ACET1B_18115) - 3463311..3463463 (+) 153 WP_000379580.1 DUF1391 family protein -
  ACET1B_RS18120 (ACET1B_18120) - 3463475..3463849 (+) 375 WP_000394557.1 hypothetical protein -
  ACET1B_RS18125 (ACET1B_18125) dicB 3464381..3464569 (+) 189 WP_000449192.1 cell division inhibition protein DicB -
  ACET1B_RS18130 (ACET1B_18130) - 3464566..3464757 (+) 192 WP_001090200.1 DUF1482 family protein -
  ACET1B_RS18135 (ACET1B_18135) - 3464850..3466262 (+) 1413 Protein_3551 exonuclease -
  ACET1B_RS18140 (ACET1B_18140) - 3466318..3467531 (+) 1214 WP_171877072.1 IS3-like element IS1203 family transposase -
  ACET1B_RS18145 (ACET1B_18145) - 3467574..3468626 (+) 1053 Protein_3553 3'-5' exoribonuclease domain-containing protein -
  ACET1B_RS18150 (ACET1B_18150) - 3468694..3468936 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  ACET1B_RS18155 (ACET1B_18155) - 3468914..3469929 (+) 1016 Protein_3555 tyrosine-type recombinase/integrase -
  ACET1B_RS18160 (ACET1B_18160) yccA 3470337..3470996 (+) 660 WP_000375138.1 FtsH protease modulator YccA -
  ACET1B_RS18165 (ACET1B_18165) tusE 3471087..3471416 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  ACET1B_RS18170 (ACET1B_18170) yccX 3471413..3471691 (-) 279 WP_000048244.1 acylphosphatase -
  ACET1B_RS18175 (ACET1B_18175) rlmI 3471786..3472976 (+) 1191 WP_000116302.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  ACET1B_RS18180 (ACET1B_18180) hspQ 3473034..3473351 (+) 318 WP_001295356.1 heat shock protein HspQ -
  ACET1B_RS18185 (ACET1B_18185) yccU 3473396..3473809 (-) 414 WP_000665217.1 CoA-binding protein -
  ACET1B_RS18190 (ACET1B_18190) yccT 3473982..3474644 (+) 663 WP_000847791.1 DUF2057 family protein -
  ACET1B_RS18195 (ACET1B_18195) mgsA 3474740..3475198 (+) 459 WP_000424181.1 methylglyoxal synthase -
  ACET1B_RS18200 (ACET1B_18200) helD 3475230..3477284 (-) 2055 WP_001297106.1 DNA helicase IV -
  ACET1B_RS18205 (ACET1B_18205) yccF 3477407..3477853 (+) 447 WP_001261235.1 YccF domain-containing protein -
  ACET1B_RS18210 (ACET1B_18210) yccS 3477863..3480025 (+) 2163 WP_000875023.1 YccS family putative transporter -
  ACET1B_RS18215 (ACET1B_18215) sxy/tfoX 3479988..3480572 (-) 585 WP_077825616.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  ACET1B_RS18220 (ACET1B_18220) sulA 3480836..3481345 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  ACET1B_RS18225 (ACET1B_18225) ompA 3481702..3482742 (+) 1041 WP_001400178.1 porin OmpA -
  ACET1B_RS18230 (ACET1B_18230) matP 3482818..3483270 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  ACET1B_RS18235 (ACET1B_18235) ycbZ 3483456..3485216 (+) 1761 WP_000156528.1 Lon protease family protein -
  ACET1B_RS18240 (ACET1B_18240) fabA 3485285..3485803 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  ACET1B_RS18245 (ACET1B_18245) rmf 3485873..3486040 (-) 168 WP_000828648.1 ribosome modulation factor -
  ACET1B_RS18250 (ACET1B_18250) pqiC 3486296..3486859 (-) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  ACET1B_RS18255 (ACET1B_18255) pqiB 3486856..3488496 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  ACET1B_RS18260 (ACET1B_18260) pqiA 3488501..3489754 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  ACET1B_RS18265 (ACET1B_18265) uup 3489884..3491791 (-) 1908 WP_000053122.1 ABC transporter ATP-binding protein -
  ACET1B_RS18270 (ACET1B_18270) rlmKL 3491803..3493911 (-) 2109 WP_001086519.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  ACET1B_RS18275 (ACET1B_18275) ycbX 3494155..3495264 (+) 1110 WP_000224312.1 6-N-hydroxylaminopurine resistance protein YcbX -
  ACET1B_RS18280 (ACET1B_18280) zapC 3495261..3495803 (-) 543 WP_001295353.1 cell division protein ZapC -

Sequence

Protein


Download         Length: 194 a.a.        Molecular weight: 22258.82 Da        Isoelectric Point: 8.4565

>NTDB_id=1049291 ACET1B_RS18215 WP_077825616.1 3479988..3480572(-) (sxy/tfoX) [Escherichia coli strain UTAK-8]
MATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKL
VRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAI
IGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 585 bp        

>NTDB_id=1049291 ACET1B_RS18215 WP_077825616.1 3479988..3480572(-) (sxy/tfoX) [Escherichia coli strain UTAK-8]
CTGGCAACGTTGGGCACAATTGAATACCGATCATTGTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGAT
GGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTGAGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGA
CATATAAAAAGTGTGGCCGATCCGTTACCCTCAATTACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTG
GTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCTGAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTT
GCCCAATATGTCTTTTCATCTGGAAGCGATTCTCGGGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGG
CAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATT
ATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACA
GGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX C-terminal domain (TfoX_C)

(101-179)

TfoX N-terminal domain (TfoX_N)

(2-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.485

100

0.995

Multiple sequence alignment