Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | AB3U57_RS10705 | Genome accession | NZ_CP168976 |
| Coordinates | 2064477..2064755 (+) | Length | 92 a.a. |
| NCBI ID | WP_150475925.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain QKG-2024 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2060219..2105161 | 2064477..2064755 | within | 0 |
Gene organization within MGE regions
Location: 2060219..2105161
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB3U57_RS10665 (AB3U57_10665) | - | 2060249..2061508 (+) | 1260 | WP_224742151.1 | AimR family lysis-lysogeny pheromone receptor | - |
| AB3U57_RS10670 (AB3U57_10670) | - | 2061690..2061821 (+) | 132 | WP_263479927.1 | hypothetical protein | - |
| AB3U57_RS10675 (AB3U57_10675) | - | 2061832..2062179 (-) | 348 | WP_023521535.1 | helix-turn-helix domain-containing protein | - |
| AB3U57_RS10680 (AB3U57_10680) | - | 2062349..2062576 (+) | 228 | WP_150475932.1 | helix-turn-helix transcriptional regulator | - |
| AB3U57_RS10685 (AB3U57_10685) | - | 2062615..2062773 (+) | 159 | WP_191092987.1 | hypothetical protein | - |
| AB3U57_RS10690 (AB3U57_10690) | - | 2062846..2063001 (+) | 156 | WP_023521538.1 | hypothetical protein | - |
| AB3U57_RS10695 (AB3U57_10695) | - | 2063057..2063377 (+) | 321 | WP_150475930.1 | hypothetical protein | - |
| AB3U57_RS10700 (AB3U57_10700) | - | 2063505..2064473 (+) | 969 | WP_373983969.1 | DnaD domain-containing protein | - |
| AB3U57_RS10705 (AB3U57_10705) | abrB | 2064477..2064755 (+) | 279 | WP_150475925.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| AB3U57_RS10710 (AB3U57_10710) | - | 2064748..2065107 (+) | 360 | WP_150475922.1 | cell division protein SepF | - |
| AB3U57_RS10715 (AB3U57_10715) | - | 2065126..2065290 (+) | 165 | WP_150475921.1 | DUF3954 domain-containing protein | - |
| AB3U57_RS10720 (AB3U57_10720) | - | 2065316..2065789 (+) | 474 | WP_150475910.1 | sugar ABC transporter substrate-binding protein | - |
| AB3U57_RS10725 (AB3U57_10725) | - | 2065815..2066324 (+) | 510 | WP_150475908.1 | dUTP diphosphatase | - |
| AB3U57_RS10730 (AB3U57_10730) | - | 2066328..2066801 (+) | 474 | WP_150475906.1 | hypothetical protein | - |
| AB3U57_RS10735 (AB3U57_10735) | - | 2066881..2067066 (+) | 186 | WP_150475904.1 | hypothetical protein | - |
| AB3U57_RS10740 (AB3U57_10740) | - | 2067441..2068160 (+) | 720 | WP_002066828.1 | hypothetical protein | - |
| AB3U57_RS10745 (AB3U57_10745) | - | 2068218..2068421 (+) | 204 | WP_265781632.1 | hypothetical protein | - |
| AB3U57_RS10750 (AB3U57_10750) | - | 2068438..2068608 (+) | 171 | WP_191092986.1 | hypothetical protein | - |
| AB3U57_RS10755 (AB3U57_10755) | - | 2068799..2069008 (+) | 210 | WP_345742617.1 | hypothetical protein | - |
| AB3U57_RS10760 (AB3U57_10760) | - | 2069040..2069324 (+) | 285 | WP_150475897.1 | hypothetical protein | - |
| AB3U57_RS10765 (AB3U57_10765) | - | 2069444..2069830 (+) | 387 | WP_098782223.1 | YopX family protein | - |
| AB3U57_RS10770 (AB3U57_10770) | - | 2069860..2070141 (+) | 282 | WP_150475895.1 | PadR family transcriptional regulator | - |
| AB3U57_RS10775 (AB3U57_10775) | - | 2070257..2070427 (+) | 171 | WP_098949026.1 | hypothetical protein | - |
| AB3U57_RS10780 (AB3U57_10780) | - | 2070455..2070937 (+) | 483 | WP_088065331.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AB3U57_RS10785 (AB3U57_10785) | - | 2070937..2071479 (+) | 543 | WP_098949027.1 | site-specific integrase | - |
| AB3U57_RS10790 (AB3U57_10790) | - | 2072145..2072507 (+) | 363 | WP_224742152.1 | HNH endonuclease signature motif containing protein | - |
| AB3U57_RS10795 (AB3U57_10795) | - | 2072607..2073128 (+) | 522 | WP_150475889.1 | phage terminase small subunit P27 family | - |
| AB3U57_RS10800 (AB3U57_10800) | - | 2073137..2074846 (+) | 1710 | WP_150475886.1 | terminase large subunit | - |
| AB3U57_RS10805 (AB3U57_10805) | - | 2074860..2076110 (+) | 1251 | WP_150475884.1 | phage portal protein | - |
| AB3U57_RS10810 (AB3U57_10810) | - | 2076091..2076783 (+) | 693 | WP_150475882.1 | head maturation protease, ClpP-related | - |
| AB3U57_RS10815 (AB3U57_10815) | - | 2076931..2077977 (+) | 1047 | WP_373983971.1 | phage major capsid protein | - |
| AB3U57_RS10820 (AB3U57_10820) | - | 2078018..2078311 (+) | 294 | WP_150475878.1 | head-tail connector protein | - |
| AB3U57_RS10825 (AB3U57_10825) | - | 2078308..2078652 (+) | 345 | WP_150475876.1 | phage head closure protein | - |
| AB3U57_RS10830 (AB3U57_10830) | - | 2078640..2079077 (+) | 438 | WP_150475874.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AB3U57_RS10835 (AB3U57_10835) | - | 2079074..2079436 (+) | 363 | WP_150475871.1 | DUF3168 domain-containing protein | - |
| AB3U57_RS10840 (AB3U57_10840) | - | 2079452..2080018 (+) | 567 | WP_150475869.1 | major tail protein | - |
| AB3U57_RS10845 (AB3U57_10845) | gpG | 2080077..2080450 (+) | 374 | Protein_2049 | phage tail assembly chaperone G | - |
| AB3U57_RS10850 (AB3U57_10850) | - | 2080615..2085597 (+) | 4983 | WP_150475864.1 | phage tail tape measure protein | - |
| AB3U57_RS10855 (AB3U57_10855) | - | 2085594..2086466 (+) | 873 | WP_150475862.1 | phage tail domain-containing protein | - |
| AB3U57_RS10860 (AB3U57_10860) | - | 2086494..2087345 (+) | 852 | WP_150475860.1 | structural protein | - |
| AB3U57_RS10865 (AB3U57_10865) | - | 2087362..2088483 (+) | 1122 | WP_150475858.1 | siphovirus ReqiPepy6 Gp37-like family protein | - |
| AB3U57_RS10870 (AB3U57_10870) | - | 2088531..2091134 (+) | 2604 | WP_150475856.1 | BppU family phage baseplate upper protein | - |
| AB3U57_RS10875 (AB3U57_10875) | - | 2091206..2091442 (+) | 237 | WP_150475853.1 | hemolysin XhlA family protein | - |
| AB3U57_RS10880 (AB3U57_10880) | - | 2091442..2091681 (+) | 240 | WP_098856097.1 | holin | - |
| AB3U57_RS10885 (AB3U57_10885) | - | 2091678..2092742 (+) | 1065 | WP_150475851.1 | N-acetylmuramoyl-L-alanine amidase | - |
| AB3U57_RS10890 (AB3U57_10890) | - | 2092807..2093421 (-) | 615 | WP_150475849.1 | hypothetical protein | - |
| AB3U57_RS10895 (AB3U57_10895) | - | 2093512..2093718 (-) | 207 | WP_371410978.1 | helix-turn-helix transcriptional regulator | - |
| AB3U57_RS10900 (AB3U57_10900) | - | 2093875..2094177 (+) | 303 | WP_150475847.1 | hypothetical protein | - |
| AB3U57_RS10905 (AB3U57_10905) | - | 2094180..2094362 (+) | 183 | WP_072192074.1 | hypothetical protein | - |
| AB3U57_RS10910 (AB3U57_10910) | - | 2094480..2095661 (+) | 1182 | WP_150475844.1 | FtsK/SpoIIIE domain-containing protein | - |
| AB3U57_RS10915 (AB3U57_10915) | - | 2095603..2096220 (+) | 618 | WP_150475842.1 | replication-relaxation family protein | - |
| AB3U57_RS10920 (AB3U57_10920) | - | 2096253..2096489 (-) | 237 | WP_000673258.1 | helix-turn-helix transcriptional regulator | - |
| AB3U57_RS10925 (AB3U57_10925) | - | 2096653..2096772 (+) | 120 | WP_023521579.1 | DUF3961 domain-containing protein | - |
| AB3U57_RS10930 (AB3U57_10930) | - | 2096788..2097651 (+) | 864 | WP_150475840.1 | helix-turn-helix domain-containing protein | - |
| AB3U57_RS10935 (AB3U57_10935) | - | 2097718..2099172 (+) | 1455 | WP_150475837.1 | recombinase family protein | - |
| AB3U57_RS10940 (AB3U57_10940) | - | 2099190..2104178 (-) | 4989 | Protein_2068 | beta strand repeat-containing protein | - |
| AB3U57_RS10945 (AB3U57_10945) | - | 2104301..2105161 (+) | 861 | WP_000571023.1 | GNAT family N-acetyltransferase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10004.61 Da Isoelectric Point: 8.0204
>NTDB_id=1049138 AB3U57_RS10705 WP_150475925.1 2064477..2064755(+) (abrB) [Bacillus cereus strain QKG-2024]
MKNTSVARKVDDLGRVVIPIELRRTLGIAEGTSLGFHVDGENIILKKQETSCFVTGKVSESNIKLLEGRMFLSKEGASEL
LDILQKSGMANA
MKNTSVARKVDDLGRVVIPIELRRTLGIAEGTSLGFHVDGENIILKKQETSCFVTGKVSESNIKLLEGRMFLSKEGASEL
LDILQKSGMANA
Nucleotide
Download Length: 279 bp
>NTDB_id=1049138 AB3U57_RS10705 WP_150475925.1 2064477..2064755(+) (abrB) [Bacillus cereus strain QKG-2024]
ATGAAAAACACAAGTGTAGCAAGAAAAGTAGATGATTTAGGGCGTGTAGTAATTCCGATTGAGTTACGCAGAACTTTGGG
AATTGCTGAAGGGACGTCATTAGGTTTTCATGTTGATGGGGAAAACATTATTTTGAAGAAACAAGAAACGTCATGCTTTG
TAACGGGTAAAGTTTCTGAATCCAACATCAAATTGCTGGAAGGTCGAATGTTTTTGAGTAAGGAAGGCGCAAGTGAATTG
CTGGACATTCTTCAAAAGAGTGGGATGGCAAATGCCTAA
ATGAAAAACACAAGTGTAGCAAGAAAAGTAGATGATTTAGGGCGTGTAGTAATTCCGATTGAGTTACGCAGAACTTTGGG
AATTGCTGAAGGGACGTCATTAGGTTTTCATGTTGATGGGGAAAACATTATTTTGAAGAAACAAGAAACGTCATGCTTTG
TAACGGGTAAAGTTTCTGAATCCAACATCAAATTGCTGGAAGGTCGAATGTTTTTGAGTAAGGAAGGCGCAAGTGAATTG
CTGGACATTCTTCAAAAGAGTGGGATGGCAAATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
58.621 |
94.565 |
0.554 |