Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   ACD268_RS08325 Genome accession   NZ_CP168299
Coordinates   1632069..1632218 (-) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain FC1     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 1633085..1633890 1632069..1632218 flank 867


Gene organization within MGE regions


Location: 1632069..1633890
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACD268_RS08325 (ACD268_08325) cipB 1632069..1632218 (-) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  ACD268_RS08330 (ACD268_08330) blpN 1632462..1632665 (-) 204 WP_001099491.1 two-peptide bacteriocin subunit BlpN -
  ACD268_RS08335 (ACD268_08335) blpM 1632681..1632935 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  ACD268_RS08340 (ACD268_08340) - 1633085..1633890 (-) 806 Protein_1651 IS5 family transposase -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=1043724 ACD268_RS08325 WP_001818346.1 1632069..1632218(-) (cipB) [Streptococcus pneumoniae strain FC1]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=1043724 ACD268_RS08325 WP_001818346.1 1632069..1632218(-) (cipB) [Streptococcus pneumoniae strain FC1]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51


Multiple sequence alignment