Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   Q433_RS05960 Genome accession   NZ_CP007409
Coordinates   1150080..1150271 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 1145080..1155271
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q433_RS05930 (Q433_06355) argF 1145944..1146903 (+) 960 WP_003232980.1 ornithine carbamoyltransferase -
  Q433_RS05935 (Q433_06360) yjzC 1146989..1147168 (+) 180 WP_003245356.1 YjzC family protein -
  Q433_RS05940 (Q433_06365) yjzD 1147214..1147399 (-) 186 WP_003245236.1 DUF2929 domain-containing protein -
  Q433_RS05945 (Q433_06370) - 1147648..1148382 (+) 735 WP_003245223.1 hypothetical protein -
  Q433_RS05950 (Q433_06380) - 1148464..1149021 (+) 558 WP_003232974.1 hypothetical protein -
  Q433_RS05955 (Q433_06385) med 1149112..1150065 (+) 954 WP_003245494.1 transcriptional regulator Med Regulator
  Q433_RS05960 (Q433_06390) comZ 1150080..1150271 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  Q433_RS05965 (Q433_06395) yjzB 1150301..1150540 (-) 240 WP_003232972.1 spore coat protein YjzB -
  Q433_RS05970 (Q433_06400) fabH 1150705..1151643 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  Q433_RS05975 (Q433_06405) fabF 1151666..1152907 (+) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  Q433_RS05980 (Q433_06410) yjaZ 1152983..1153768 (+) 786 WP_003232967.1 DUF2268 domain-containing protein -
  Q433_RS05985 (Q433_06415) appD 1153960..1154946 (+) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=104328 Q433_RS05960 WP_003224559.1 1150080..1150271(+) (comZ) [Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=104328 Q433_RS05960 WP_003224559.1 1150080..1150271(+) (comZ) [Bacillus subtilis subsp. subtilis str. OH 131.1 strain OH131.1]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterProScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment