Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACEF29_RS16535 Genome accession   NZ_CP168150
Coordinates   3276672..3276812 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain CM19     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3271672..3281812
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACEF29_RS16515 (ACEF29_16515) - 3271969..3272352 (-) 384 WP_053574130.1 hotdog fold thioesterase -
  ACEF29_RS16520 (ACEF29_16520) comA 3272374..3273018 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACEF29_RS16525 (ACEF29_16525) comP 3273099..3275402 (-) 2304 WP_040238945.1 histidine kinase Regulator
  ACEF29_RS16530 (ACEF29_16530) comQ 3275555..3276541 (-) 987 WP_269195024.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ACEF29_RS16535 (ACEF29_16535) degQ 3276672..3276812 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACEF29_RS16540 (ACEF29_16540) - 3277275..3277616 (+) 342 WP_007408677.1 hypothetical protein -
  ACEF29_RS16545 (ACEF29_16545) - 3277623..3278846 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  ACEF29_RS16550 (ACEF29_16550) - 3278976..3280442 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  ACEF29_RS16555 (ACEF29_16555) - 3280460..3281011 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACEF29_RS16560 (ACEF29_16560) - 3281108..3281506 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1042641 ACEF29_RS16535 WP_003152043.1 3276672..3276812(-) (degQ) [Bacillus velezensis strain CM19]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1042641 ACEF29_RS16535 WP_003152043.1 3276672..3276812(-) (degQ) [Bacillus velezensis strain CM19]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment