Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   ACEF29_RS01995 Genome accession   NZ_CP168150
Coordinates   429192..429311 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain CM19     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 424192..434311
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACEF29_RS01980 (ACEF29_01980) - 425804..426487 (+) 684 WP_007410267.1 response regulator transcription factor -
  ACEF29_RS01985 (ACEF29_01985) - 426474..427907 (+) 1434 WP_162782989.1 HAMP domain-containing sensor histidine kinase -
  ACEF29_RS01990 (ACEF29_01990) rapC 428060..429208 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  ACEF29_RS01995 (ACEF29_01995) phrC 429192..429311 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACEF29_RS02000 (ACEF29_02000) - 429460..429570 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACEF29_RS02005 (ACEF29_02005) - 429650..431014 (-) 1365 WP_033575080.1 aspartate kinase -
  ACEF29_RS02010 (ACEF29_02010) ceuB 431428..432381 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  ACEF29_RS02015 (ACEF29_02015) - 432371..433318 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  ACEF29_RS02020 (ACEF29_02020) - 433312..434070 (+) 759 WP_053573731.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1042589 ACEF29_RS01995 WP_003156334.1 429192..429311(+) (phrC) [Bacillus velezensis strain CM19]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1042589 ACEF29_RS01995 WP_003156334.1 429192..429311(+) (phrC) [Bacillus velezensis strain CM19]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment