Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   KJP56_RS13730 Genome accession   NZ_OX419652
Coordinates   2560219..2560602 (-) Length   127 a.a.
NCBI ID   WP_101502451.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6131     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2555219..2565602
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP56_RS13690 (NRS6131_13640) sinI 2556152..2556325 (+) 174 WP_014477323.1 anti-repressor SinI family protein Regulator
  KJP56_RS13695 (NRS6131_13645) sinR 2556359..2556694 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP56_RS13700 (NRS6131_13650) tasA 2556786..2557571 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  KJP56_RS13705 (NRS6131_13655) sipW 2557636..2558208 (-) 573 WP_134991456.1 signal peptidase I -
  KJP56_RS13710 (NRS6131_13660) tapA 2558192..2558953 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  KJP56_RS13715 (NRS6131_13665) yqzG 2559225..2559551 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP56_RS13720 (NRS6131_13670) spoIIT 2559593..2559772 (-) 180 WP_014480252.1 YqzE family protein -
  KJP56_RS13725 (NRS6131_13675) comGG 2559844..2560218 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  KJP56_RS13730 (NRS6131_13680) comGF 2560219..2560602 (-) 384 WP_101502451.1 ComG operon protein ComGF Machinery gene
  KJP56_RS13735 (NRS6131_13685) comGE 2560628..2560975 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene
  KJP56_RS13740 (NRS6131_13690) comGD 2560959..2561390 (-) 432 WP_101502452.1 comG operon protein ComGD Machinery gene
  KJP56_RS13745 (NRS6131_13695) comGC 2561380..2561676 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  KJP56_RS13750 (NRS6131_13700) comGB 2561690..2562727 (-) 1038 WP_153529795.1 comG operon protein ComGB Machinery gene
  KJP56_RS13755 (NRS6131_13705) comGA 2562714..2563784 (-) 1071 WP_153529796.1 competence protein ComGA Machinery gene
  KJP56_RS13760 - 2563996..2564121 (-) 126 WP_003230155.1 hypothetical protein -
  KJP56_RS13765 (NRS6131_13715) corA 2564187..2565140 (-) 954 WP_072173930.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14296.34 Da        Isoelectric Point: 5.8277

>NTDB_id=1041691 KJP56_RS13730 WP_101502451.1 2560219..2560602(-) (comGF) [Bacillus subtilis isolate NRS6131]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIHFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1041691 KJP56_RS13730 WP_101502451.1 2560219..2560602(-) (comGF) [Bacillus subtilis isolate NRS6131]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCATTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984