Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACDZ81_RS16540 Genome accession   NZ_CP168028
Coordinates   3276672..3276812 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain CM5 isolate     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3271672..3281812
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACDZ81_RS16520 (ACDZ81_16520) - 3271969..3272352 (-) 384 WP_053574130.1 hotdog fold thioesterase -
  ACDZ81_RS16525 (ACDZ81_16525) comA 3272374..3273018 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACDZ81_RS16530 (ACDZ81_16530) comP 3273099..3275402 (-) 2304 WP_040238945.1 histidine kinase Regulator
  ACDZ81_RS16535 (ACDZ81_16535) comQ 3275555..3276541 (-) 987 WP_269195024.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ACDZ81_RS16540 (ACDZ81_16540) degQ 3276672..3276812 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACDZ81_RS16545 (ACDZ81_16545) - 3277275..3277616 (+) 342 WP_007408677.1 hypothetical protein -
  ACDZ81_RS16550 (ACDZ81_16550) - 3277623..3278846 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  ACDZ81_RS16555 (ACDZ81_16555) - 3278976..3280442 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  ACDZ81_RS16560 (ACDZ81_16560) - 3280460..3281011 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACDZ81_RS16565 (ACDZ81_16565) - 3281108..3281506 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1041652 ACDZ81_RS16540 WP_003152043.1 3276672..3276812(-) (degQ) [Bacillus velezensis strain CM5 isolate]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1041652 ACDZ81_RS16540 WP_003152043.1 3276672..3276812(-) (degQ) [Bacillus velezensis strain CM5 isolate]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment