Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   ACDZ81_RS01995 Genome accession   NZ_CP168028
Coordinates   429192..429311 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain CM5 isolate     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 424192..434311
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACDZ81_RS01980 (ACDZ81_01980) - 425804..426487 (+) 684 WP_007410267.1 response regulator transcription factor -
  ACDZ81_RS01985 (ACDZ81_01985) - 426474..427907 (+) 1434 WP_162782989.1 HAMP domain-containing sensor histidine kinase -
  ACDZ81_RS01990 (ACDZ81_01990) rapC 428060..429208 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  ACDZ81_RS01995 (ACDZ81_01995) phrC 429192..429311 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACDZ81_RS02000 (ACDZ81_02000) - 429460..429570 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACDZ81_RS02005 (ACDZ81_02005) - 429650..431014 (-) 1365 WP_033575080.1 aspartate kinase -
  ACDZ81_RS02010 (ACDZ81_02010) ceuB 431428..432381 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  ACDZ81_RS02015 (ACDZ81_02015) - 432371..433318 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  ACDZ81_RS02020 (ACDZ81_02020) - 433312..434070 (+) 759 WP_053573731.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1041600 ACDZ81_RS01995 WP_003156334.1 429192..429311(+) (phrC) [Bacillus velezensis strain CM5 isolate]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1041600 ACDZ81_RS01995 WP_003156334.1 429192..429311(+) (phrC) [Bacillus velezensis strain CM5 isolate]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment