Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   ACDZ80_RS13060 Genome accession   NZ_CP168027
Coordinates   2637451..2637888 (-) Length   145 a.a.
NCBI ID   WP_012117983.1    Uniprot ID   -
Organism   Bacillus velezensis strain CM35 isolate     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2632451..2642888
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACDZ80_RS13010 (ACDZ80_13010) sinI 2632835..2633008 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACDZ80_RS13015 (ACDZ80_13015) sinR 2633042..2633377 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACDZ80_RS13020 (ACDZ80_13020) tasA 2633425..2634210 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACDZ80_RS13025 (ACDZ80_13025) sipW 2634275..2634859 (-) 585 WP_015240205.1 signal peptidase I SipW -
  ACDZ80_RS13030 (ACDZ80_13030) tapA 2634831..2635502 (-) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  ACDZ80_RS13035 (ACDZ80_13035) - 2635761..2636090 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  ACDZ80_RS13040 (ACDZ80_13040) - 2636130..2636309 (-) 180 WP_003153093.1 YqzE family protein -
  ACDZ80_RS13045 (ACDZ80_13045) comGG 2636366..2636743 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACDZ80_RS13050 (ACDZ80_13050) comGF 2636744..2637244 (-) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  ACDZ80_RS13055 (ACDZ80_13055) comGE 2637153..2637467 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ACDZ80_RS13060 (ACDZ80_13060) comGD 2637451..2637888 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACDZ80_RS13065 (ACDZ80_13065) comGC 2637878..2638186 (-) 309 WP_079979070.1 competence type IV pilus major pilin ComGC Machinery gene
  ACDZ80_RS13070 (ACDZ80_13070) comGB 2638191..2639228 (-) 1038 WP_053573197.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACDZ80_RS13075 (ACDZ80_13075) comGA 2639215..2640285 (-) 1071 WP_053573196.1 competence type IV pilus ATPase ComGA Machinery gene
  ACDZ80_RS13080 (ACDZ80_13080) - 2640478..2641428 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  ACDZ80_RS13085 (ACDZ80_13085) - 2641574..2642875 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.74 Da        Isoelectric Point: 10.2475

>NTDB_id=1041556 ACDZ80_RS13060 WP_012117983.1 2637451..2637888(-) (comGD) [Bacillus velezensis strain CM35 isolate]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1041556 ACDZ80_RS13060 WP_012117983.1 2637451..2637888(-) (comGD) [Bacillus velezensis strain CM35 isolate]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572


Multiple sequence alignment