Detailed information NTG1041556

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ACDZ80_RS13060
• Genome accession: NZ_CP168027
• Coordinates: 2637451..2637888 (-)
• Length: 145 a.a.
• NCBI ID: WP_012117983.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain CM35 isolate
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2632451..2642888

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACDZ80_RS13010 (ACDZ80_13010)	sinI	2632835..2633008 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
ACDZ80_RS13015 (ACDZ80_13015)	sinR	2633042..2633377 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACDZ80_RS13020 (ACDZ80_13020)	tasA	2633425..2634210 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
ACDZ80_RS13025 (ACDZ80_13025)	sipW	2634275..2634859 (-)	585	WP_015240205.1	signal peptidase I SipW	-
ACDZ80_RS13030 (ACDZ80_13030)	tapA	2634831..2635502 (-)	672	WP_053573199.1	amyloid fiber anchoring/assembly protein TapA	-
ACDZ80_RS13035 (ACDZ80_13035)	-	2635761..2636090 (+)	330	WP_039254490.1	DUF3889 domain-containing protein	-
ACDZ80_RS13040 (ACDZ80_13040)	-	2636130..2636309 (-)	180	WP_003153093.1	YqzE family protein	-
ACDZ80_RS13045 (ACDZ80_13045)	comGG	2636366..2636743 (-)	378	WP_015417814.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACDZ80_RS13050 (ACDZ80_13050)	comGF	2636744..2637244 (-)	501	WP_256052909.1	competence type IV pilus minor pilin ComGF	-
ACDZ80_RS13055 (ACDZ80_13055)	comGE	2637153..2637467 (-)	315	WP_012117982.1	competence type IV pilus minor pilin ComGE	-
ACDZ80_RS13060 (ACDZ80_13060)	comGD	2637451..2637888 (-)	438	WP_012117983.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACDZ80_RS13065 (ACDZ80_13065)	comGC	2637878..2638186 (-)	309	WP_079979070.1	competence type IV pilus major pilin ComGC	Machinery gene
ACDZ80_RS13070 (ACDZ80_13070)	comGB	2638191..2639228 (-)	1038	WP_053573197.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACDZ80_RS13075 (ACDZ80_13075)	comGA	2639215..2640285 (-)	1071	WP_053573196.1	competence type IV pilus ATPase ComGA	Machinery gene
ACDZ80_RS13080 (ACDZ80_13080)	-	2640478..2641428 (-)	951	WP_015417820.1	magnesium transporter CorA family protein	-
ACDZ80_RS13085 (ACDZ80_13085)	-	2641574..2642875 (+)	1302	WP_012117986.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16286.74 Da
• Isoelectric Point: 10.2475

>NTDB_id=1041556 ACDZ80_RS13060 WP_012117983.1 2637451..2637888(-) (comGD) [Bacillus velezensis strain CM35 isolate]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1041556 ACDZ80_RS13060 WP_012117983.1 2637451..2637888(-) (comGD) [Bacillus velezensis strain CM35 isolate]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.849	100	0.572