Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | ACDZ79_RS14780 | Genome accession | NZ_CP168025 |
| Coordinates | 2998374..2998514 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain EM39 isolate | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2993374..3003514
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACDZ79_RS14755 (ACDZ79_14755) | - | 2993720..2994103 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| ACDZ79_RS14760 (ACDZ79_14760) | comA | 2994125..2994769 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| ACDZ79_RS14765 (ACDZ79_14765) | comP | 2994850..2997150 (-) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| ACDZ79_RS14770 (ACDZ79_14770) | comX | 2997164..2997337 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| ACDZ79_RS14775 (ACDZ79_14775) | - | 2997306..2998166 (-) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| ACDZ79_RS14780 (ACDZ79_14780) | degQ | 2998374..2998514 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| ACDZ79_RS14785 (ACDZ79_14785) | - | 2998980..2999321 (+) | 342 | WP_032876795.1 | hypothetical protein | - |
| ACDZ79_RS14790 (ACDZ79_14790) | - | 2999328..3000551 (-) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| ACDZ79_RS14795 (ACDZ79_14795) | - | 3000681..3002147 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| ACDZ79_RS14800 (ACDZ79_14800) | - | 3002165..3002716 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| ACDZ79_RS14805 (ACDZ79_14805) | - | 3002813..3003211 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=1041422 ACDZ79_RS14780 WP_003152043.1 2998374..2998514(-) (degQ) [Bacillus velezensis strain EM39 isolate]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=1041422 ACDZ79_RS14780 WP_003152043.1 2998374..2998514(-) (degQ) [Bacillus velezensis strain EM39 isolate]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |