Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   KJP51_RS12265 Genome accession   NZ_OX419576
Coordinates   2403197..2403571 (-) Length   124 a.a.
NCBI ID   WP_015251714.1    Uniprot ID   -
Organism   Bacillus subtilis isolate NRS6105     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2398197..2408571
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP51_RS12225 (NRS6105_12130) yqhG 2398529..2399323 (+) 795 WP_003230200.1 YqhG family protein -
  KJP51_RS12230 (NRS6105_12135) sinI 2399506..2399679 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP51_RS12235 (NRS6105_12140) sinR 2399713..2400048 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP51_RS12240 (NRS6105_12145) tasA 2400141..2400926 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  KJP51_RS12245 (NRS6105_12150) sipW 2400990..2401562 (-) 573 WP_003246088.1 signal peptidase I -
  KJP51_RS12250 (NRS6105_12155) tapA 2401546..2402307 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  KJP51_RS12255 (NRS6105_12160) yqzG 2402579..2402905 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP51_RS12260 (NRS6105_12165) spoIIT 2402947..2403126 (-) 180 WP_003230176.1 YqzE family protein -
  KJP51_RS12265 (NRS6105_12170) comGG 2403197..2403571 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  KJP51_RS12270 comGF 2403572..2403955 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  KJP51_RS12275 (NRS6105_12180) comGE 2403981..2404328 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  KJP51_RS12280 (NRS6105_12185) comGD 2404312..2404743 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  KJP51_RS12285 (NRS6105_12190) comGC 2404733..2405029 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  KJP51_RS12290 (NRS6105_12195) comGB 2405043..2406080 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  KJP51_RS12295 (NRS6105_12200) comGA 2406067..2407137 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  KJP51_RS12300 (NRS6105_12210) - 2407350..2407547 (-) 198 WP_014480259.1 CBS domain-containing protein -
  KJP51_RS12305 (NRS6105_12215) corA 2407549..2408502 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14540.73 Da        Isoelectric Point: 8.7849

>NTDB_id=1040935 KJP51_RS12265 WP_015251714.1 2403197..2403571(-) (comGG) [Bacillus subtilis isolate NRS6105]
MYRTRGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1040935 KJP51_RS12265 WP_015251714.1 2403197..2403571(-) (comGG) [Bacillus subtilis isolate NRS6105]
ATGTACCGTACGAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATCGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

96.774

100

0.968


Multiple sequence alignment