Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   KJP59_RS16730 Genome accession   NZ_OX419570
Coordinates   3198776..3198943 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis isolate NRS6134     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3193776..3203943
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP59_RS16700 (NRS6134_16590) mrpE 3194171..3194647 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  KJP59_RS16705 (NRS6134_16595) mrpF 3194647..3194931 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  KJP59_RS16710 (NRS6134_16600) mnhG 3194915..3195289 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  KJP59_RS16715 (NRS6134_16605) yuxO 3195328..3195708 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  KJP59_RS16720 (NRS6134_16610) comA 3195727..3196371 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP59_RS16725 (NRS6134_16615) comP 3196452..3198761 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  KJP59_RS16730 (NRS6134_16620) comX 3198776..3198943 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  KJP59_RS16735 (NRS6134_16625) comQ 3198931..3199830 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  KJP59_RS16740 (NRS6134_16630) degQ 3200015..3200155 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP59_RS16745 - 3200377..3200502 (+) 126 WP_003228793.1 hypothetical protein -
  KJP59_RS16750 (NRS6134_16635) - 3200616..3200984 (+) 369 WP_003243784.1 hypothetical protein -
  KJP59_RS16755 (NRS6134_16640) pdeH 3200960..3202189 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP59_RS16760 (NRS6134_16645) pncB 3202326..3203798 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=1040504 KJP59_RS16730 WP_003242801.1 3198776..3198943(-) (comX) [Bacillus subtilis isolate NRS6134]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1040504 KJP59_RS16730 WP_003242801.1 3198776..3198943(-) (comX) [Bacillus subtilis isolate NRS6134]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment