Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP59_RS12865 Genome accession   NZ_OX419570
Coordinates   2495366..2495539 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis isolate NRS6134     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2490366..2500539
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP59_RS12850 (NRS6134_12800) gcvT 2491165..2492253 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP59_RS12855 (NRS6134_12805) yqhH 2492695..2494368 (+) 1674 WP_003230203.1 SNF2-related protein -
  KJP59_RS12860 (NRS6134_12810) yqhG 2494389..2495183 (+) 795 WP_003230200.1 YqhG family protein -
  KJP59_RS12865 (NRS6134_12815) sinI 2495366..2495539 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP59_RS12870 (NRS6134_12820) sinR 2495573..2495908 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP59_RS12875 (NRS6134_12825) tasA 2496001..2496786 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  KJP59_RS12880 (NRS6134_12830) sipW 2496850..2497422 (-) 573 WP_003230181.1 signal peptidase I -
  KJP59_RS12885 (NRS6134_12835) tapA 2497406..2498167 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  KJP59_RS12890 (NRS6134_12840) yqzG 2498439..2498765 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP59_RS12895 (NRS6134_12845) spoIIT 2498807..2498986 (-) 180 WP_003230176.1 YqzE family protein -
  KJP59_RS12900 (NRS6134_12850) comGG 2499057..2499431 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  KJP59_RS12905 (NRS6134_12855) comGF 2499432..2499815 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  KJP59_RS12910 (NRS6134_12860) comGE 2499841..2500188 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1040469 KJP59_RS12865 WP_003230187.1 2495366..2495539(+) (sinI) [Bacillus subtilis isolate NRS6134]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1040469 KJP59_RS12865 WP_003230187.1 2495366..2495539(+) (sinI) [Bacillus subtilis isolate NRS6134]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1