Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   KJP64_RS12240 Genome accession   NZ_OX419565
Coordinates   2394468..2394641 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis isolate NRS6145     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2389468..2399641
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP64_RS12225 (NRS6145_12090) gcvT 2390267..2391355 (-) 1089 WP_213379484.1 glycine cleavage system aminomethyltransferase GcvT -
  KJP64_RS12230 (NRS6145_12095) yqhH 2391797..2393470 (+) 1674 WP_213379486.1 SNF2-related protein -
  KJP64_RS12235 (NRS6145_12100) yqhG 2393491..2394285 (+) 795 WP_003230200.1 YqhG family protein -
  KJP64_RS12240 (NRS6145_12105) sinI 2394468..2394641 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  KJP64_RS12245 (NRS6145_12110) sinR 2394675..2395010 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  KJP64_RS12250 (NRS6145_12115) tasA 2395103..2395888 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  KJP64_RS12255 (NRS6145_12120) sipW 2395952..2396524 (-) 573 WP_003246088.1 signal peptidase I -
  KJP64_RS12260 (NRS6145_12125) tapA 2396508..2397269 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  KJP64_RS12265 (NRS6145_12130) yqzG 2397541..2397867 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  KJP64_RS12270 (NRS6145_12135) spoIIT 2397909..2398088 (-) 180 WP_003230176.1 YqzE family protein -
  KJP64_RS12275 (NRS6145_12140) comGG 2398159..2398533 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  KJP64_RS12280 comGF 2398534..2398917 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  KJP64_RS12285 (NRS6145_12150) comGE 2398943..2399290 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1039999 KJP64_RS12240 WP_003230187.1 2394468..2394641(+) (sinI) [Bacillus subtilis isolate NRS6145]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1039999 KJP64_RS12240 WP_003230187.1 2394468..2394641(+) (sinI) [Bacillus subtilis isolate NRS6145]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1