Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   ACBW56_RS11780 Genome accession   NZ_CP167196
Coordinates   2418864..2418983 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain FRI-TD24     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 2413864..2423983
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACBW56_RS11755 (ACBW56_11755) - 2414103..2414861 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  ACBW56_RS11760 (ACBW56_11760) - 2414855..2415802 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  ACBW56_RS11765 (ACBW56_11765) ceuB 2415792..2416745 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  ACBW56_RS11770 (ACBW56_11770) - 2417160..2418524 (+) 1365 WP_014304341.1 aspartate kinase -
  ACBW56_RS11775 (ACBW56_11775) - 2418604..2418714 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACBW56_RS11780 (ACBW56_11780) phrC 2418864..2418983 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACBW56_RS11785 (ACBW56_11785) rapC 2418967..2420115 (-) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  ACBW56_RS11790 (ACBW56_11790) - 2420268..2421701 (-) 1434 WP_161625271.1 HAMP domain-containing sensor histidine kinase -
  ACBW56_RS11795 (ACBW56_11795) - 2421688..2422371 (-) 684 WP_003156341.1 response regulator transcription factor -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1038778 ACBW56_RS11780 WP_003156334.1 2418864..2418983(-) (phrC) [Bacillus velezensis strain FRI-TD24]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1038778 ACBW56_RS11780 WP_003156334.1 2418864..2418983(-) (phrC) [Bacillus velezensis strain FRI-TD24]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment