Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   AD178_RS02885 Genome accession   NZ_OX244288
Coordinates   556223..556372 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   Q9FBH1
Organism   Streptococcus pneumoniae strain PT8105 isolate 2RLC4     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 551223..561372
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AD178_RS02860 (SAMEA1463109_00573) - 552825..553028 (+) 204 WP_001093272.1 bacteriocin class II family protein -
  AD178_RS02865 (SAMEA1463109_00574) - 553346..553549 (+) 204 WP_000411016.1 hypothetical protein -
  AD178_RS02870 - 554552..555356 (+) 805 Protein_566 IS5 family transposase -
  AD178_RS02875 (SAMEA1463109_00578) blpM 555506..555760 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  AD178_RS02880 (SAMEA1463109_00579) blpN 555776..555979 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  AD178_RS02885 (SAMEA1463109_00580) cipB 556223..556372 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  AD178_RS02890 - 556476..556595 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  AD178_RS02895 (SAMEA1463109_00581) - 557381..557764 (+) 384 WP_000877381.1 hypothetical protein -
  AD178_RS02900 (SAMEA1463109_00582) - 557816..558505 (+) 690 WP_000760529.1 CPBP family intramembrane glutamic endopeptidase -
  AD178_RS02905 (SAMEA1463109_00583) blpZ 558547..558795 (+) 249 WP_000276499.1 immunity protein BlpZ -
  AD178_RS02910 (SAMEA1463109_00584) - 558825..559436 (+) 612 WP_000394045.1 type II CAAX endopeptidase family protein -
  AD178_RS02915 (SAMEA1463109_00585) ccrZ 559597..560391 (+) 795 WP_000363002.1 cell cycle regulator CcrZ -
  AD178_RS02920 (SAMEA1463109_00586) trmB 560388..561023 (+) 636 WP_001266077.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=1037515 AD178_RS02885 WP_001818346.1 556223..556372(+) (cipB) [Streptococcus pneumoniae strain PT8105 isolate 2RLC4]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=1037515 AD178_RS02885 WP_001818346.1 556223..556372(+) (cipB) [Streptococcus pneumoniae strain PT8105 isolate 2RLC4]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9FBH1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51


Multiple sequence alignment