Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ACB342_RS05070 | Genome accession | NZ_CP167007 |
| Coordinates | 1008451..1008639 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain Isolate 24 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1000867..1047176 | 1008451..1008639 | within | 0 |
Gene organization within MGE regions
Location: 1000867..1047176
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACB342_RS05035 (ACB342_05040) | pfkA | 1000867..1001880 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| ACB342_RS05040 (ACB342_05045) | - | 1001960..1005070 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| ACB342_RS05045 (ACB342_05050) | - | 1005255..1005626 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| ACB342_RS05050 (ACB342_05055) | - | 1005626..1006324 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ACB342_RS05055 (ACB342_05060) | - | 1006334..1007119 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| ACB342_RS05060 (ACB342_05065) | - | 1007246..1007860 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| ACB342_RS05070 (ACB342_05075) | prx | 1008451..1008639 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| ACB342_RS05075 (ACB342_05080) | speA | 1008859..1009614 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| ACB342_RS05080 (ACB342_05085) | - | 1009736..1010395 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| ACB342_RS05085 (ACB342_05090) | - | 1010395..1010616 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| ACB342_RS05090 (ACB342_05095) | - | 1010626..1011399 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| ACB342_RS05095 (ACB342_05100) | - | 1011410..1012012 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| ACB342_RS05100 (ACB342_05105) | - | 1012024..1012788 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| ACB342_RS05105 (ACB342_05110) | - | 1012790..1013122 (-) | 333 | WP_011285562.1 | phage holin | - |
| ACB342_RS05110 (ACB342_05115) | - | 1013122..1013445 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| ACB342_RS05115 (ACB342_05120) | - | 1013459..1013581 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| ACB342_RS05120 (ACB342_05125) | - | 1013595..1013942 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| ACB342_RS05125 (ACB342_05130) | - | 1013953..1015815 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| ACB342_RS05130 (ACB342_05135) | - | 1015820..1019260 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| ACB342_RS05135 (ACB342_05140) | - | 1019261..1020745 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| ACB342_RS05140 (ACB342_05145) | - | 1020746..1022551 (-) | 1806 | WP_011054802.1 | tail protein | - |
| ACB342_RS05145 (ACB342_05150) | - | 1022544..1023002 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| ACB342_RS05150 (ACB342_05155) | - | 1022975..1023292 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| ACB342_RS05155 (ACB342_05160) | - | 1023305..1023811 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| ACB342_RS05160 (ACB342_05165) | - | 1023823..1024233 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| ACB342_RS05165 (ACB342_05170) | - | 1024235..1024630 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| ACB342_RS05170 (ACB342_05175) | - | 1024627..1024938 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| ACB342_RS05175 (ACB342_05180) | - | 1024935..1025279 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| ACB342_RS05180 (ACB342_05185) | - | 1025293..1025586 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| ACB342_RS05185 (ACB342_05190) | - | 1025599..1026489 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| ACB342_RS05190 (ACB342_05195) | - | 1026508..1027077 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| ACB342_RS05195 (ACB342_05200) | - | 1027322..1027591 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| ACB342_RS05200 (ACB342_05205) | - | 1027598..1028506 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| ACB342_RS05205 (ACB342_05210) | - | 1028475..1029800 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| ACB342_RS05210 (ACB342_05215) | - | 1029800..1031074 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| ACB342_RS05215 (ACB342_05220) | - | 1031064..1031444 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| ACB342_RS05220 (ACB342_05225) | - | 1032054..1032488 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACB342_RS05225 (ACB342_05230) | - | 1032773..1033039 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| ACB342_RS05230 (ACB342_05235) | - | 1033036..1033560 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| ACB342_RS05235 (ACB342_05240) | - | 1033563..1034195 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| ACB342_RS05240 (ACB342_05245) | - | 1034197..1034481 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| ACB342_RS05245 (ACB342_05250) | - | 1034478..1034648 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| ACB342_RS05250 (ACB342_05255) | - | 1034645..1034881 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| ACB342_RS05255 (ACB342_05260) | - | 1034881..1035126 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| ACB342_RS05260 (ACB342_05265) | - | 1035123..1035479 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| ACB342_RS05265 (ACB342_05270) | - | 1035476..1035916 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACB342_RS05270 (ACB342_05275) | - | 1035916..1036119 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| ACB342_RS05275 (ACB342_05280) | ssb | 1036125..1036550 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| ACB342_RS05280 (ACB342_05285) | - | 1036543..1037217 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| ACB342_RS05285 (ACB342_05290) | - | 1037218..1037700 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| ACB342_RS05290 (ACB342_05295) | - | 1037722..1037976 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| ACB342_RS05295 (ACB342_05300) | - | 1037957..1038310 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| ACB342_RS05300 (ACB342_05305) | - | 1038451..1039233 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| ACB342_RS05305 (ACB342_05310) | - | 1039220..1040050 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACB342_RS05310 (ACB342_05315) | - | 1040064..1040252 (-) | 189 | Protein_997 | XRE family transcriptional regulator | - |
| ACB342_RS05315 (ACB342_05320) | - | 1040486..1040725 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| ACB342_RS05320 (ACB342_05325) | - | 1040856..1041065 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| ACB342_RS05325 (ACB342_05330) | - | 1041175..1041375 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| ACB342_RS05330 (ACB342_05335) | - | 1041449..1041835 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| ACB342_RS05335 (ACB342_05340) | - | 1041824..1042033 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| ACB342_RS05340 (ACB342_05345) | - | 1042087..1042686 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| ACB342_RS05345 (ACB342_05350) | - | 1042716..1042874 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| ACB342_RS05350 (ACB342_05355) | - | 1043231..1044055 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| ACB342_RS05355 (ACB342_05360) | - | 1044091..1044984 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| ACB342_RS05360 (ACB342_05365) | - | 1045105..1046193 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| ACB342_RS05365 (ACB342_05370) | - | 1046556..1047176 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=1037201 ACB342_RS05070 WP_011285559.1 1008451..1008639(-) (prx) [Streptococcus pyogenes strain Isolate 24]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=1037201 ACB342_RS05070 WP_011285559.1 1008451..1008639(-) (prx) [Streptococcus pyogenes strain Isolate 24]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |