Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   AB3239_RS13275 Genome accession   NZ_CP166831
Coordinates   2553554..2553727 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain TE3T-UV25     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2548554..2558727
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3239_RS13260 (AB3239_13260) gcvT 2549352..2550440 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  AB3239_RS13265 (AB3239_13265) hepAA 2550882..2552555 (+) 1674 WP_038829735.1 DEAD/DEAH box helicase -
  AB3239_RS13270 (AB3239_13270) yqhG 2552576..2553370 (+) 795 WP_370956869.1 YqhG family protein -
  AB3239_RS13275 (AB3239_13275) sinI 2553554..2553727 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  AB3239_RS13280 (AB3239_13280) sinR 2553761..2554096 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB3239_RS13285 (AB3239_13285) tasA 2554188..2554973 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  AB3239_RS13290 (AB3239_13290) sipW 2555038..2555610 (-) 573 WP_003246088.1 signal peptidase I SipW -
  AB3239_RS13295 (AB3239_13295) tapA 2555594..2556355 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  AB3239_RS13300 (AB3239_13300) yqzG 2556626..2556952 (+) 327 WP_038829733.1 YqzG/YhdC family protein -
  AB3239_RS13305 (AB3239_13305) spoIITA 2556994..2557173 (-) 180 WP_014480252.1 YqzE family protein -
  AB3239_RS13310 (AB3239_13310) comGG 2557245..2557619 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  AB3239_RS13315 (AB3239_13315) comGF 2557620..2558003 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  AB3239_RS13320 (AB3239_13320) comGE 2558029..2558376 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=1035530 AB3239_RS13275 WP_014477323.1 2553554..2553727(+) (sinI) [Bacillus subtilis strain TE3T-UV25]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1035530 AB3239_RS13275 WP_014477323.1 2553554..2553727(+) (sinI) [Bacillus subtilis strain TE3T-UV25]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982

Multiple sequence alignment