Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   AB6K15_RS08340 Genome accession   NZ_CP166492
Coordinates   1758896..1759015 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain BC248L1-1     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 1753896..1764015
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB6K15_RS08315 (AB6K15_08320) - 1754138..1754896 (-) 759 WP_012116804.1 ABC transporter ATP-binding protein -
  AB6K15_RS08320 (AB6K15_08325) - 1754890..1755837 (-) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  AB6K15_RS08325 (AB6K15_08330) ceuB 1755827..1756780 (-) 954 WP_059366593.1 ABC transporter permease Machinery gene
  AB6K15_RS08330 (AB6K15_08335) - 1757194..1758558 (+) 1365 WP_094031502.1 aspartate kinase -
  AB6K15_RS08335 (AB6K15_08340) - 1758638..1758748 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  AB6K15_RS08340 (AB6K15_08345) phrC 1758896..1759015 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AB6K15_RS08345 (AB6K15_08350) rapC 1758999..1760147 (-) 1149 WP_012116798.1 Rap family tetratricopeptide repeat protein Regulator
  AB6K15_RS08350 (AB6K15_08355) - 1760300..1761733 (-) 1434 WP_162492834.1 HAMP domain-containing sensor histidine kinase -
  AB6K15_RS08355 (AB6K15_08360) - 1761720..1762403 (-) 684 WP_007410267.1 response regulator transcription factor -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1034734 AB6K15_RS08340 WP_003156334.1 1758896..1759015(-) (phrC) [Bacillus velezensis strain BC248L1-1]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1034734 AB6K15_RS08340 WP_003156334.1 1758896..1759015(-) (phrC) [Bacillus velezensis strain BC248L1-1]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment