Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   AB6911_RS02180 Genome accession   NZ_CP166481
Coordinates   441454..441573 (+) Length   39 a.a.
NCBI ID   WP_004430266.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain globigii     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 436454..446573
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB6911_RS02155 (AB6911_02145) - 436616..437365 (+) 750 WP_013390756.1 amino acid ABC transporter ATP-binding protein -
  AB6911_RS02160 (AB6911_02150) - 437381..438532 (+) 1152 WP_004430254.1 M20 peptidase aminoacylase family protein -
  AB6911_RS02165 (AB6911_02155) - 438529..439875 (+) 1347 WP_004430256.1 MmgE/PrpD family protein -
  AB6911_RS02170 (AB6911_02160) - 439918..440127 (+) 210 Protein_394 ATP-binding protein -
  AB6911_RS02175 (AB6911_02165) rapC 440322..441470 (+) 1149 WP_004430265.1 tetratricopeptide repeat protein Regulator
  AB6911_RS02180 (AB6911_02170) phrC 441454..441573 (+) 120 WP_004430266.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  AB6911_RS02185 (AB6911_02175) - 441708..441815 (-) 108 WP_072053240.1 YjcZ family sporulation protein -
  AB6911_RS02190 (AB6911_02180) - 442019..442102 (-) 84 WP_370499808.1 YjcZ family sporulation protein -
  AB6911_RS02195 (AB6911_02185) - 442233..443597 (-) 1365 WP_004430267.1 aspartate kinase -
  AB6911_RS02200 (AB6911_02190) ceuB 444030..444980 (+) 951 WP_004430268.1 ABC transporter permease Machinery gene
  AB6911_RS02205 (AB6911_02195) - 444973..445920 (+) 948 WP_004430269.1 iron chelate uptake ABC transporter family permease subunit -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4111.89 Da        Isoelectric Point: 7.9858

>NTDB_id=1034639 AB6911_RS02180 WP_004430266.1 441454..441573(+) (phrC) [Bacillus atrophaeus strain globigii]
MKLKSKLLIICLAAAAVFATVGVSNAEAPDYQVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1034639 AB6911_RS02180 WP_004430266.1 441454..441573(+) (phrC) [Bacillus atrophaeus strain globigii]
ATGAAATTGAAATCTAAATTGCTCATTATTTGTTTGGCTGCAGCTGCTGTGTTTGCAACAGTTGGAGTGTCCAATGCTGA
AGCGCCTGATTATCAGGTGACAGAAAGAGGAATGACGTAA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

75

100

0.769

Multiple sequence alignment