Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   QUE82_RS16335 Genome accession   NZ_AP028059
Coordinates   3051061..3051201 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. natto strain NARUSE     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3046061..3056201
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QUE82_RS16310 (BSNN_31830) yuxO 3046338..3046718 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  QUE82_RS16315 (BSNN_31840) comA 3046737..3047381 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QUE82_RS16320 (BSNN_31850) comP 3047462..3049774 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  QUE82_RS16325 (BSNN_31860) comX 3049790..3050011 (-) 222 WP_014480704.1 competence pheromone ComX -
  QUE82_RS16330 (BSNN_31870) - 3050013..3050876 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  QUE82_RS16335 (BSNN_31880) degQ 3051061..3051201 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QUE82_RS16340 - 3051423..3051548 (+) 126 WP_003228793.1 hypothetical protein -
  QUE82_RS16345 (BSNN_31890) - 3051662..3052030 (+) 369 WP_014477834.1 hypothetical protein -
  QUE82_RS16350 (BSNN_31900) pdeH 3052006..3053235 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  QUE82_RS16355 (BSNN_31910) pncB 3053371..3054843 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  QUE82_RS16360 (BSNN_31920) pncA 3054859..3055410 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  QUE82_RS16365 (BSNN_31930) yueI 3055507..3055905 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=103423 QUE82_RS16335 WP_003220708.1 3051061..3051201(-) (degQ) [Bacillus subtilis subsp. natto strain NARUSE]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=103423 QUE82_RS16335 WP_003220708.1 3051061..3051201(-) (degQ) [Bacillus subtilis subsp. natto strain NARUSE]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment