Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | QUE82_RS12765 | Genome accession | NZ_AP028059 |
| Coordinates | 2385502..2385675 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. natto strain NARUSE | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2380502..2390675
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QUE82_RS12750 (BSNN_25020) | gcvT | 2381301..2382389 (-) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| QUE82_RS12755 (BSNN_25030) | hepAA | 2382831..2384504 (+) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| QUE82_RS12760 (BSNN_25040) | yqhG | 2384525..2385319 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| QUE82_RS12765 (BSNN_25050) | sinI | 2385502..2385675 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| QUE82_RS12770 (BSNN_25060) | sinR | 2385709..2386044 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| QUE82_RS12775 (BSNN_25070) | tasA | 2386137..2386922 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| QUE82_RS12780 (BSNN_25080) | sipW | 2386986..2387558 (-) | 573 | WP_003230181.1 | signal peptidase I SipW | - |
| QUE82_RS12785 (BSNN_25090) | tapA | 2387542..2388303 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| QUE82_RS12790 (BSNN_25100) | yqzG | 2388575..2388901 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| QUE82_RS12795 (BSNN_25110) | spoIITA | 2388943..2389122 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| QUE82_RS12800 (BSNN_25120) | comGG | 2389193..2389567 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| QUE82_RS12805 (BSNN_25130) | comGF | 2389568..2389951 (-) | 384 | WP_014480254.1 | ComG operon protein ComGF | Machinery gene |
| QUE82_RS12810 (BSNN_25140) | comGE | 2389977..2390324 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=103399 QUE82_RS12765 WP_003230187.1 2385502..2385675(+) (sinI) [Bacillus subtilis subsp. natto strain NARUSE]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=103399 QUE82_RS12765 WP_003230187.1 2385502..2385675(+) (sinI) [Bacillus subtilis subsp. natto strain NARUSE]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |