Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   STAB1101_RS00665 Genome accession   NZ_CP007240
Coordinates   104755..105039 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain 7F7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99755..110039
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  STAB1101_RS00640 (STAB1101_00640) - 101700..102065 (+) 366 WP_002986560.1 DUF1033 family protein -
  STAB1101_RS00645 (STAB1101_00645) comGA 102158..103096 (+) 939 WP_002993471.1 competence type IV pilus ATPase ComGA Machinery gene
  STAB1101_RS00650 (STAB1101_00650) comGB 103032..104067 (+) 1036 Protein_82 competence type IV pilus assembly protein ComGB -
  STAB1101_RS00655 (STAB1101_00655) comGC 104069..104395 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  STAB1101_RS00660 (STAB1101_00660) comGD 104370..104798 (+) 429 WP_023605232.1 competence type IV pilus minor pilin ComGD Machinery gene
  STAB1101_RS00665 (STAB1101_00665) comGE 104755..105039 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  STAB1101_RS00670 (STAB1101_00670) comGF 105032..105466 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  STAB1101_RS00675 (STAB1101_00675) comGG 105450..105776 (+) 327 WP_002992739.1 competence type IV pilus minor pilin ComGG -
  STAB1101_RS00680 (STAB1101_00680) comGH 105874..106827 (+) 954 WP_023610092.1 class I SAM-dependent methyltransferase Machinery gene
  STAB1101_RS00685 (STAB1101_00685) - 106886..108082 (+) 1197 WP_038431193.1 acetate kinase -
  STAB1101_RS00690 (STAB1101_00690) - 108269..108577 (+) 309 WP_032467031.1 hypothetical protein -
  STAB1101_RS00695 (STAB1101_00695) proC 108660..109430 (-) 771 WP_002992745.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=103382 STAB1101_RS00665 WP_011284422.1 104755..105039(+) (comGE) [Streptococcus pyogenes strain 7F7]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=103382 STAB1101_RS00665 WP_011284422.1 104755..105039(+) (comGE) [Streptococcus pyogenes strain 7F7]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTTGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383