Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   JNUCC21_RS09015 Genome accession   NZ_CP166019
Coordinates   1827168..1827602 (+) Length   144 a.a.
NCBI ID   WP_136396382.1    Uniprot ID   -
Organism   Bacillus sp. JNUCC-21     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1828528..1860017 1827168..1827602 flank 926
IScluster/Tn 1828528..1829678 1827168..1827602 flank 926


Gene organization within MGE regions


Location: 1827168..1860017
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JNUCC21_RS09015 (JNUCC21_09035) nucA/comI 1827168..1827602 (+) 435 WP_136396382.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  JNUCC21_RS09020 (JNUCC21_09040) - 1827662..1828417 (+) 756 WP_369878752.1 YoaK family protein -
  JNUCC21_RS09025 (JNUCC21_09045) - 1828528..1829678 (+) 1151 WP_369878753.1 IS3 family transposase -
  JNUCC21_RS09030 (JNUCC21_09050) - 1829740..1830102 (-) 363 WP_007410383.1 hypothetical protein -
  JNUCC21_RS09035 (JNUCC21_09055) - 1830295..1831623 (-) 1329 WP_012117603.1 S8 family peptidase -
  JNUCC21_RS09040 (JNUCC21_09060) - 1831802..1832035 (+) 234 WP_015239897.1 hypothetical protein -
  JNUCC21_RS09045 (JNUCC21_09065) - 1832291..1832998 (+) 708 WP_012117604.1 poly-gamma-glutamate hydrolase family protein -
  JNUCC21_RS09050 (JNUCC21_09070) - 1833058..1833510 (+) 453 WP_012117605.1 OsmC family protein -
  JNUCC21_RS09055 (JNUCC21_09075) - 1833524..1833877 (-) 354 WP_007410379.1 multidrug efflux SMR transporter -
  JNUCC21_RS09060 (JNUCC21_09080) - 1833895..1834209 (-) 315 WP_007410378.1 multidrug efflux SMR transporter -
  JNUCC21_RS09065 (JNUCC21_09085) - 1834347..1834664 (-) 318 WP_032866021.1 hypothetical protein -
  JNUCC21_RS09070 (JNUCC21_09090) - 1834766..1835170 (+) 405 WP_014417831.1 YmaF family protein -
  JNUCC21_RS09075 (JNUCC21_09095) miaA 1835269..1836213 (+) 945 WP_015239900.1 tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA -
  JNUCC21_RS09080 (JNUCC21_09100) hfq 1836253..1836474 (+) 222 WP_003154064.1 RNA chaperone Hfq -
  JNUCC21_RS09085 (JNUCC21_09105) - 1836572..1836847 (+) 276 WP_032871539.1 YmzC family protein -
  JNUCC21_RS09090 (JNUCC21_09110) - 1836930..1837145 (+) 216 WP_003154062.1 hypothetical protein -
  JNUCC21_RS09095 (JNUCC21_09115) nrdI 1837405..1837797 (+) 393 WP_003154061.1 class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI -
  JNUCC21_RS09100 (JNUCC21_09120) nrdE 1837757..1839859 (+) 2103 WP_007611605.1 class 1b ribonucleoside-diphosphate reductase subunit alpha -
  JNUCC21_RS09105 (JNUCC21_09125) nrdF 1839877..1840866 (+) 990 WP_012117608.1 class 1b ribonucleoside-diphosphate reductase subunit beta -
  JNUCC21_RS09110 (JNUCC21_09130) - 1840915..1841535 (+) 621 WP_369878754.1 hypothetical protein -
  JNUCC21_RS09115 (JNUCC21_09135) - 1841585..1842328 (-) 744 WP_369878755.1 N-acetylmuramoyl-L-alanine amidase -
  JNUCC21_RS09120 (JNUCC21_09140) spoVK 1842635..1843603 (+) 969 WP_015417523.1 stage V sporulation protein K -
  JNUCC21_RS09125 (JNUCC21_09145) hflX 1843733..1844995 (+) 1263 WP_369878756.1 GTPase HflX -
  JNUCC21_RS09130 (JNUCC21_09150) - 1845012..1846277 (+) 1266 WP_012117612.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
  JNUCC21_RS09135 (JNUCC21_09155) - 1846387..1846791 (+) 405 WP_007410366.1 MerR family transcriptional regulator -
  JNUCC21_RS09140 (JNUCC21_09160) glnA 1846849..1848183 (+) 1335 WP_007410365.1 type I glutamate--ammonia ligase -
  JNUCC21_RS09145 (JNUCC21_09165) - 1848502..1848768 (+) 267 Protein_1748 ArpU family phage packaging/lysis transcriptional regulator -
  JNUCC21_RS09150 (JNUCC21_09170) - 1848871..1849500 (+) 630 WP_041482194.1 hypothetical protein -
  JNUCC21_RS09155 (JNUCC21_09175) - 1850171..1850758 (+) 588 WP_144664669.1 hypothetical protein -
  JNUCC21_RS09160 (JNUCC21_09180) - 1850979..1851572 (+) 594 WP_144664668.1 hypothetical protein -
  JNUCC21_RS09165 (JNUCC21_09185) - 1851633..1851968 (+) 336 WP_064107798.1 holin family protein -
  JNUCC21_RS09170 (JNUCC21_09190) - 1852011..1852876 (+) 866 Protein_1753 N-acetylmuramoyl-L-alanine amidase -
  JNUCC21_RS09175 (JNUCC21_09195) - 1852938..1854257 (+) 1320 WP_369878757.1 Kelch repeat-containing protein -
  JNUCC21_RS09180 (JNUCC21_09200) - 1854262..1854375 (+) 114 Protein_1755 peptidoglycan-binding protein -
  JNUCC21_RS09185 (JNUCC21_09205) - 1854428..1854868 (-) 441 WP_048367302.1 SMI1/KNR4 family protein -
  JNUCC21_RS09190 (JNUCC21_09210) - 1854883..1856709 (-) 1827 WP_369878758.1 T7SS effector LXG polymorphic toxin -
  JNUCC21_RS09195 (JNUCC21_09215) - 1856771..1857826 (-) 1056 WP_369878759.1 DUF4917 family protein -
  JNUCC21_RS09200 (JNUCC21_09220) - 1858923..1860017 (-) 1095 WP_369878760.1 L-dopachrome tautomerase-related protein -

Sequence


Protein


Download         Length: 144 a.a.        Molecular weight: 15544.47 Da        Isoelectric Point: 7.2418

>NTDB_id=1033119 JNUCC21_RS09015 WP_136396382.1 1827168..1827602(+) (nucA/comI) [Bacillus sp. JNUCC-21]
MNAFMKWAASLLLVISLQFGLTGAGIHSDSAARAASRYDQVLYFPLSKYPETGNHIKDAISTGHSEICTIDRGGAENRRK
ESLKGIPTKPGFDRDEWPMAVCTEGGAGADVRYVTPSDNRGAGSWVGNQMSGYSDGTRVLFIVQ

Nucleotide


Download         Length: 435 bp        

>NTDB_id=1033119 JNUCC21_RS09015 WP_136396382.1 1827168..1827602(+) (nucA/comI) [Bacillus sp. JNUCC-21]
ATGAATGCGTTTATGAAATGGGCGGCAAGTCTGCTTTTGGTGATCTCTCTTCAGTTCGGCCTTACGGGCGCCGGTATCCA
TTCGGACAGTGCTGCTCGTGCCGCATCCCGATACGATCAGGTGCTGTATTTCCCGCTGTCAAAATATCCGGAGACGGGAA
ATCATATAAAAGACGCCATTTCGACAGGTCATTCTGAGATTTGTACAATTGATCGGGGCGGAGCAGAGAATAGAAGGAAA
GAATCATTGAAAGGAATTCCGACAAAGCCCGGGTTTGACCGTGATGAATGGCCCATGGCAGTCTGCACAGAAGGCGGGGC
GGGGGCTGATGTCAGATATGTAACCCCATCAGATAACCGCGGGGCCGGTTCATGGGTTGGAAATCAAATGAGCGGATATT
CCGACGGCACGAGAGTATTATTTATCGTTCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

57.258

86.111

0.493


Multiple sequence alignment