Detailed information NTG0001030

Experimentally validated

Overview

• Name: pilA/pilA1
• Type: Machinery gene
• Locus tag: TT_RS04315
• Genome accession: NC_005835
• Coordinates: 831428..831898 (+)
• Length: 156 a.a.
• NCBI ID: WP_011173283.1
• Uniprot ID: -
• Organism: Thermus thermophilus HB27
• Function: assembly of type IV pilus DNA binding and uptake

Function

A subcomplex in the IM comprising of PilMNOC forms the base for retraction and extension of the T4P structures comprising the major pilin PilA4 and the DNA translocator pseudopilus comprising PilA4 and the minor pilins PilA1–3.

Genomic Context

Location: 826428..836898

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
TT_RS04295 (TT_C0850)	ilvC	826928..827941 (-)	1014	WP_011173279.1	ketol-acid reductoisomerase	-
TT_RS04300 (TT_C0851)	ilvN	827938..828450 (-)	513	WP_011173280.1	acetolactate synthase small subunit	-
TT_RS04305 (TT_C0852)	ilvB	828447..830135 (-)	1689	WP_011173281.1	biosynthetic-type acetolactate synthase large subunit	-
TT_RS04310 (TT_C0853)	-	830290..831270 (-)	981	WP_011173282.1	YpdA family putative bacillithiol disulfide reductase	-
TT_RS04315 (TT_C0854)	pilA/pilA1	831428..831898 (+)	471	WP_011173283.1	GspH/FimT family protein	Machinery gene
TT_RS04320 (TT_C0855)	pilA/pilA2	831932..832513 (+)	582	WP_011173284.1	type IV pilus modification PilV family protein	Machinery gene
TT_RS04325 (TT_C0856)	pilA/pilA3	832510..833211 (+)	702	WP_011173285.1	PilW family protein	Machinery gene
TT_RS04330 (TT_C0857)	comZ	833222..834886 (+)	1665	WP_011173286.1	pilus assembly PilX N-terminal domain-containing protein	Machinery gene
TT_RS11945 (TT_C0858)	pilA/pilA4	835117..835512 (+)	396	WP_011173287.1	type IV wide pilus major component PilA4	Machinery gene
TT_RS11645	-	835569..836861 (-)	1293	WP_143591263.1	O-antigen ligase family protein	-

Sequence

Protein

• Length: 156 a.a.
• Molecular weight: 16884.66 Da
• Isoelectric Point: 11.5286

>NTDB_id=1030 TT_RS04315 WP_011173283.1 831428..831898(+) (pilA/pilA1) [Thermus thermophilus HB27]
MTRRGLTLLELLLVLGILGVLLGLALPLLSPNRLALDQAARSLATQVTRARLEAIRRNAFVGLQVFTEGAGGYLLFVDQN
ANRRYDPGEEFGATHFGQGNWARVRLDPEKSALGNMPLLFDPRGIPAKPITATLVLTSGGATRKVVISQQGRARLE

Nucleotide

• Length: 471 bp

>NTDB_id=1030 TT_RS04315 WP_011173283.1 831428..831898(+) (pilA/pilA1) [Thermus thermophilus HB27]
ATGACTCGGCGGGGCCTTACCCTTTTGGAGCTCCTGCTGGTTTTGGGCATCCTGGGGGTCCTCCTAGGGCTGGCCCTTCC
ACTTCTTTCCCCCAACCGCCTCGCCCTGGACCAGGCCGCCCGCTCCCTCGCCACCCAGGTGACCCGGGCAAGGCTCGAGG
CCATCCGCCGGAACGCCTTCGTGGGCCTTCAGGTGTTCACCGAAGGAGCGGGGGGTTACCTGCTCTTCGTGGACCAAAAC
GCCAACCGCCGCTACGACCCCGGGGAGGAGTTCGGCGCGACCCACTTCGGCCAAGGGAACTGGGCCCGGGTGCGCCTGGA
CCCGGAGAAGAGCGCCCTCGGCAACATGCCCCTTCTCTTTGACCCCCGGGGCATCCCGGCCAAGCCCATCACCGCCACGC
TCGTCCTCACCTCAGGGGGCGCCACCCGCAAGGTGGTCATCTCCCAGCAGGGCCGGGCCCGCCTGGAGTGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (3-26)

• Type II transport protein GspH (GspH) (39-151)

References

• [1]: Lennart Kirchner et al. (2022) DNA binding by pilins and their interaction with the inner membrane platform of the DNA transporter in Thermus thermophilus. Biochimica Et Biophysica Acta. Biomembranes 1864(1):183818. [PMID: 34774498]
• [2]: Beate Averhoff et al. (2021) Natural transformation in Gram-negative bacteria thriving in extreme environments: from genes and genomes to proteins, structures and regulation. Extremophiles : Life Under Extreme Conditions 25(5-6):425-436. [PMID: 34542714]
• [3]: Cornelia Schwarzenlander et al. (2009) The role of single subunits of the DNA transport machinery of Thermus thermophilus HB27 in DNA binding and transport. Environmental Microbiology 11(4):801-8. [PMID: 19396940]
• [4]: Alexandra Friedrich et al. (2003) Pilin-like proteins in the extremely thermophilic bacterium Thermus thermophilus HB27: implication in competence for natural transformation and links to type IV pilus biogenesis. Applied And Environmental Microbiology 69(7):3695-700. [PMID: 12839734]