Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   CS894_RS00225 Genome accession   NZ_LT635456
Coordinates   40239..40352 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   -
Organism   Helicobacter pylori isolate HE101/09     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 35239..45352
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CS894_RS00200 - 35280..37508 (+) 2229 WP_089086473.1 AAA family ATPase -
  CS894_RS00205 panD 37498..37851 (+) 354 WP_000142286.1 aspartate 1-decarboxylase -
  CS894_RS00210 - 37854..38156 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  CS894_RS00215 - 38156..39160 (+) 1005 WP_089086474.1 PDZ domain-containing protein -
  CS894_RS00220 comB6 39168..40223 (+) 1056 WP_089086475.1 P-type conjugative transfer protein TrbL Machinery gene
  CS894_RS00225 comB7 40239..40352 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  CS894_RS00230 comB8 40349..41092 (+) 744 WP_000660557.1 type IV secretion system protein Machinery gene
  CS894_RS00235 comB9 41092..42078 (+) 987 WP_089086476.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CS894_RS00240 comB10 42071..43207 (+) 1137 WP_089086477.1 DNA type IV secretion system protein ComB10 Machinery gene
  CS894_RS00245 - 43277..44689 (+) 1413 WP_089086478.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=1029922 CS894_RS00225 WP_001217877.1 40239..40352(+) (comB7) [Helicobacter pylori isolate HE101/09]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=1029922 CS894_RS00225 WP_001217877.1 40239..40352(+) (comB7) [Helicobacter pylori isolate HE101/09]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973