Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AB5991_RS16285 Genome accession   NZ_CP163447
Coordinates   3033898..3034038 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SD2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3028898..3039038
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB5991_RS16260 (AB5991_16260) yuxO 3029175..3029555 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  AB5991_RS16265 (AB5991_16265) comA 3029574..3030218 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AB5991_RS16270 (AB5991_16270) comP 3030299..3032611 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  AB5991_RS16275 (AB5991_16275) comX 3032627..3032848 (-) 222 WP_014480704.1 competence pheromone ComX -
  AB5991_RS16280 (AB5991_16280) - 3032850..3033713 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  AB5991_RS16285 (AB5991_16285) degQ 3033898..3034038 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AB5991_RS16290 (AB5991_16290) - 3034260..3034385 (+) 126 WP_003228793.1 hypothetical protein -
  AB5991_RS16295 (AB5991_16295) - 3034499..3034867 (+) 369 WP_014477834.1 hypothetical protein -
  AB5991_RS16300 (AB5991_16300) pdeH 3034843..3036072 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  AB5991_RS16305 (AB5991_16305) pncB 3036208..3037680 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  AB5991_RS16310 (AB5991_16310) pncA 3037696..3038247 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  AB5991_RS16315 (AB5991_16315) yueI 3038344..3038742 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1029879 AB5991_RS16285 WP_003220708.1 3033898..3034038(-) (degQ) [Bacillus subtilis strain SD2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1029879 AB5991_RS16285 WP_003220708.1 3033898..3034038(-) (degQ) [Bacillus subtilis strain SD2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment