Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   AB6A33_RS11715 Genome accession   NZ_CP163446
Coordinates   2439199..2439576 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain Hao 2023     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2434199..2444576
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB6A33_RS11675 (AB6A33_11675) - 2434696..2435490 (+) 795 WP_007612541.1 YqhG family protein -
  AB6A33_RS11680 (AB6A33_11680) sinI 2435667..2435840 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  AB6A33_RS11685 (AB6A33_11685) sinR 2435874..2436209 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB6A33_RS11690 (AB6A33_11690) tasA 2436257..2437042 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  AB6A33_RS11695 (AB6A33_11695) sipW 2437107..2437691 (-) 585 WP_032874025.1 signal peptidase I SipW -
  AB6A33_RS11700 (AB6A33_11700) tapA 2437663..2438334 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  AB6A33_RS11705 (AB6A33_11705) - 2438593..2438922 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  AB6A33_RS11710 (AB6A33_11710) - 2438963..2439142 (-) 180 WP_022552966.1 YqzE family protein -
  AB6A33_RS11715 (AB6A33_11715) comGG 2439199..2439576 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB6A33_RS11720 (AB6A33_11720) comGF 2439577..2440077 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  AB6A33_RS11725 (AB6A33_11725) comGE 2439986..2440300 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  AB6A33_RS11730 (AB6A33_11730) comGD 2440284..2440721 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB6A33_RS11735 (AB6A33_11735) comGC 2440711..2441019 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AB6A33_RS11740 (AB6A33_11740) comGB 2441024..2442061 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB6A33_RS11745 (AB6A33_11745) comGA 2442048..2443118 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  AB6A33_RS11750 (AB6A33_11750) - 2443315..2444265 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=1029782 AB6A33_RS11715 WP_032874019.1 2439199..2439576(-) (comGG) [Bacillus velezensis strain Hao 2023]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1029782 AB6A33_RS11715 WP_032874019.1 2439199..2439576(-) (comGG) [Bacillus velezensis strain Hao 2023]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488


Multiple sequence alignment