Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | AB4K17_RS13015 | Genome accession | NZ_CP162505 |
| Coordinates | 2522186..2522464 (+) | Length | 92 a.a. |
| NCBI ID | WP_368506255.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain DJ29 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2513356..2555748 | 2522186..2522464 | within | 0 |
Gene organization within MGE regions
Location: 2513356..2555748
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB4K17_RS12945 (AB4K17_12945) | - | 2513356..2513619 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| AB4K17_RS12950 (AB4K17_12950) | - | 2514176..2514487 (+) | 312 | WP_001071365.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| AB4K17_RS12955 (AB4K17_12955) | - | 2514664..2514767 (+) | 104 | Protein_2471 | site-specific integrase | - |
| AB4K17_RS12960 (AB4K17_12960) | - | 2514977..2515462 (+) | 486 | WP_002041181.1 | hypothetical protein | - |
| AB4K17_RS12965 (AB4K17_12965) | - | 2515774..2516475 (+) | 702 | WP_368506251.1 | DUF3962 domain-containing protein | - |
| AB4K17_RS12970 (AB4K17_12970) | - | 2516514..2517623 (-) | 1110 | WP_368506252.1 | tyrosine-type recombinase/integrase | - |
| AB4K17_RS12975 (AB4K17_12975) | - | 2518169..2519320 (+) | 1152 | WP_368506253.1 | AimR family lysis-lysogeny pheromone receptor | - |
| AB4K17_RS12980 (AB4K17_12980) | - | 2519358..2519504 (+) | 147 | WP_000720921.1 | hypothetical protein | - |
| AB4K17_RS12985 (AB4K17_12985) | - | 2519591..2519788 (+) | 198 | WP_000910484.1 | hypothetical protein | - |
| AB4K17_RS12990 (AB4K17_12990) | - | 2519826..2520179 (-) | 354 | WP_000491236.1 | helix-turn-helix domain-containing protein | - |
| AB4K17_RS12995 (AB4K17_12995) | - | 2520380..2520571 (+) | 192 | WP_000854271.1 | helix-turn-helix domain-containing protein | - |
| AB4K17_RS13000 (AB4K17_13000) | - | 2520627..2520893 (+) | 267 | WP_000522030.1 | helix-turn-helix domain-containing protein | - |
| AB4K17_RS13005 (AB4K17_13005) | - | 2520893..2521057 (+) | 165 | WP_000390287.1 | hypothetical protein | - |
| AB4K17_RS13010 (AB4K17_13010) | - | 2521115..2522182 (+) | 1068 | WP_368506254.1 | DnaD domain-containing protein | - |
| AB4K17_RS13015 (AB4K17_13015) | abrB | 2522186..2522464 (+) | 279 | WP_368506255.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| AB4K17_RS13020 (AB4K17_13020) | - | 2522457..2522816 (+) | 360 | WP_368506256.1 | cell division protein SepF | - |
| AB4K17_RS13025 (AB4K17_13025) | - | 2522835..2523002 (+) | 168 | WP_000717828.1 | DUF3954 domain-containing protein | - |
| AB4K17_RS13030 (AB4K17_13030) | - | 2523029..2523280 (+) | 252 | WP_368506257.1 | helix-turn-helix domain containing protein | - |
| AB4K17_RS13035 (AB4K17_13035) | - | 2523300..2523755 (+) | 456 | WP_001102014.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| AB4K17_RS13040 (AB4K17_13040) | - | 2523969..2524697 (-) | 729 | WP_368506258.1 | glycosyltransferase family 2 protein | - |
| AB4K17_RS13045 (AB4K17_13045) | - | 2524973..2525762 (-) | 790 | Protein_2489 | sulfotransferase family 2 domain-containing protein | - |
| AB4K17_RS13050 (AB4K17_13050) | - | 2525900..2526298 (+) | 399 | WP_137396790.1 | YopX family protein | - |
| AB4K17_RS13055 (AB4K17_13055) | - | 2526729..2526866 (+) | 138 | WP_078404562.1 | hypothetical protein | - |
| AB4K17_RS13060 (AB4K17_13060) | - | 2527548..2527775 (+) | 228 | WP_078404564.1 | hypothetical protein | - |
| AB4K17_RS13065 (AB4K17_13065) | - | 2528171..2528380 (+) | 210 | WP_078404566.1 | hypothetical protein | - |
| AB4K17_RS13070 (AB4K17_13070) | - | 2529076..2530413 (+) | 1338 | WP_277542651.1 | exosporium glycoprotein BclB-related protein | - |
| AB4K17_RS13075 (AB4K17_13075) | - | 2530773..2530943 (+) | 171 | WP_086692812.1 | hypothetical protein | - |
| AB4K17_RS13080 (AB4K17_13080) | - | 2530971..2531453 (+) | 483 | WP_000166189.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AB4K17_RS13085 (AB4K17_13085) | - | 2531453..2531995 (+) | 543 | WP_001012113.1 | site-specific integrase | - |
| AB4K17_RS13090 (AB4K17_13090) | - | 2532671..2532931 (+) | 261 | WP_000124642.1 | hypothetical protein | - |
| AB4K17_RS13095 (AB4K17_13095) | - | 2533073..2533336 (+) | 264 | WP_086692499.1 | hydrolase | - |
| AB4K17_RS13100 (AB4K17_13100) | - | 2533320..2533592 (+) | 273 | WP_368506259.1 | hypothetical protein | - |
| AB4K17_RS13105 (AB4K17_13105) | - | 2533588..2533923 (+) | 336 | WP_044795324.1 | HNH endonuclease | - |
| AB4K17_RS13110 (AB4K17_13110) | - | 2534076..2534411 (+) | 336 | WP_000124848.1 | P27 family phage terminase small subunit | - |
| AB4K17_RS13115 (AB4K17_13115) | - | 2534408..2536066 (+) | 1659 | WP_166572196.1 | terminase TerL endonuclease subunit | - |
| AB4K17_RS13120 (AB4K17_13120) | - | 2536132..2537238 (+) | 1107 | WP_086400969.1 | phage portal protein | - |
| AB4K17_RS13125 (AB4K17_13125) | - | 2537222..2537998 (+) | 777 | WP_086400965.1 | head maturation protease, ClpP-related | - |
| AB4K17_RS13130 (AB4K17_13130) | - | 2538018..2539181 (+) | 1164 | WP_098213917.1 | phage major capsid protein | - |
| AB4K17_RS13135 (AB4K17_13135) | - | 2539194..2539487 (+) | 294 | WP_086401727.1 | hypothetical protein | - |
| AB4K17_RS13140 (AB4K17_13140) | - | 2539489..2539842 (+) | 354 | WP_061457257.1 | phage head closure protein | - |
| AB4K17_RS13145 (AB4K17_13145) | - | 2539844..2540185 (+) | 342 | WP_368506260.1 | HK97 gp10 family phage protein | - |
| AB4K17_RS13150 (AB4K17_13150) | - | 2540185..2540514 (+) | 330 | WP_368506261.1 | hypothetical protein | - |
| AB4K17_RS13155 (AB4K17_13155) | - | 2540515..2541102 (+) | 588 | WP_368506262.1 | major tail protein | - |
| AB4K17_RS13160 (AB4K17_13160) | - | 2541107..2541469 (+) | 363 | WP_086401730.1 | hypothetical protein | - |
| AB4K17_RS13165 (AB4K17_13165) | - | 2541700..2545320 (+) | 3621 | WP_368506263.1 | DUF2207 domain-containing protein | - |
| AB4K17_RS13170 (AB4K17_13170) | - | 2545362..2546825 (+) | 1464 | WP_240835181.1 | distal tail protein Dit | - |
| AB4K17_RS13175 (AB4K17_13175) | - | 2546822..2551345 (+) | 4524 | WP_368506264.1 | phage tail spike protein | - |
| AB4K17_RS13180 (AB4K17_13180) | - | 2551357..2551737 (+) | 381 | WP_368506265.1 | hypothetical protein | - |
| AB4K17_RS13185 (AB4K17_13185) | - | 2551772..2552197 (+) | 426 | WP_030028294.1 | holin family protein | - |
| AB4K17_RS13190 (AB4K17_13190) | - | 2552197..2553132 (+) | 936 | WP_368506266.1 | N-acetylmuramoyl-L-alanine amidase | - |
| AB4K17_RS13195 (AB4K17_13195) | - | 2553163..2553414 (-) | 252 | WP_368506267.1 | YolD-like family protein | - |
| AB4K17_RS13200 (AB4K17_13200) | - | 2553552..2554595 (+) | 1044 | WP_097850606.1 | hypothetical protein | - |
| AB4K17_RS13205 (AB4K17_13205) | - | 2554573..2554959 (+) | 387 | WP_097850605.1 | ASCH domain-containing protein | - |
| AB4K17_RS13210 (AB4K17_13210) | - | 2554959..2555480 (+) | 522 | WP_097850604.1 | ATP-binding protein | - |
| AB4K17_RS13215 (AB4K17_13215) | - | 2555512..2555748 (+) | 237 | WP_097850603.1 | DUF3850 domain-containing protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10038.71 Da Isoelectric Point: 7.2802
>NTDB_id=1026652 AB4K17_RS13015 WP_368506255.1 2522186..2522464(+) (abrB) [Bacillus cereus strain DJ29]
MKNTGVARKVDELGRVVIPIELRRTLGIAEGTALGFHVEGENIVLRKHEKSCFVKGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGLAHA
MKNTGVARKVDELGRVVIPIELRRTLGIAEGTALGFHVEGENIVLRKHEKSCFVKGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGLAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=1026652 AB4K17_RS13015 WP_368506255.1 2522186..2522464(+) (abrB) [Bacillus cereus strain DJ29]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGATGAGCTAGGTCGTGTAGTAATTCCAATAGAGTTACGTAGAACTTTAGG
AATTGCTGAAGGTACAGCGTTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACACGAAAAGTCATGCTTTG
TAAAGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGCGGGCTGGCACATGCCTAA
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGATGAGCTAGGTCGTGTAGTAATTCCAATAGAGTTACGTAGAACTTTAGG
AATTGCTGAAGGTACAGCGTTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACACGAAAAGTCATGCTTTG
TAAAGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGGATCTTATTCAGAAGAGCGGGCTGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
59.77 |
94.565 |
0.565 |