Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   DQL14_RS01180 Genome accession   NZ_LS483488
Coordinates   244886..244999 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori NCTC 11637 = CCUG 17874 = ATCC 43504 = JCM 12093 strain NCTC 11637     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 239886..249999
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQL14_RS01155 (NCTC11637_00233) - 239939..242164 (+) 2226 WP_108169554.1 AAA family ATPase -
  DQL14_RS01160 (NCTC11637_00234) panD 242154..242507 (+) 354 WP_000142226.1 aspartate 1-decarboxylase -
  DQL14_RS01165 (NCTC11637_00235) - 242510..242812 (+) 303 WP_000347928.1 YbaB/EbfC family nucleoid-associated protein -
  DQL14_RS01170 (NCTC11637_00236) - 242812..243807 (+) 996 WP_108169555.1 PDZ domain-containing protein -
  DQL14_RS01175 (NCTC11637_00237) comB6 243815..244870 (+) 1056 WP_108169556.1 P-type conjugative transfer protein TrbL Machinery gene
  DQL14_RS01180 (NCTC11637_00238) comB7 244886..244999 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  DQL14_RS01185 (NCTC11637_00239) comB8 244996..245733 (+) 738 WP_000660523.1 type IV secretion system protein Machinery gene
  DQL14_RS01190 (NCTC11637_00240) comB9 245733..246713 (+) 981 WP_108169557.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  DQL14_RS01195 (NCTC11637_00241) comB10 246706..247842 (+) 1137 WP_108169558.1 DNA type IV secretion system protein ComB10 Machinery gene
  DQL14_RS01200 (NCTC11637_00242) - 247913..249325 (+) 1413 WP_108169559.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=1025976 DQL14_RS01180 WP_001217873.1 244886..244999(+) (comB7) [Helicobacter pylori NCTC 11637 = CCUG 17874 = ATCC 43504 = JCM 12093 strain NCTC 11637]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=1025976 DQL14_RS01180 WP_001217873.1 244886..244999(+) (comB7) [Helicobacter pylori NCTC 11637 = CCUG 17874 = ATCC 43504 = JCM 12093 strain NCTC 11637]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1