Detailed information    

experimental Experimentally validated

Overview


Name   pilO   Type   Machinery gene
Locus tag   TT_RS05135 Genome accession   NC_005835
Coordinates   993508..994089 (+) Length   193 a.a.
NCBI ID   WP_011173434.1    Uniprot ID   Q72IW6
Organism   Thermus thermophilus HB27     
Function   assembly of type IV pilus   
DNA binding and uptake

Function


The DNA translocator of T. thermophilus HB27 contains at least 15 components (Table 2), many of them are also essential for T4P biogenesis such as the assembly ATPase PilF which powers the DNA transporter, the IM assembly platform comprising of PilMNO, the unique PilW protein, the major pilin PilA4 and the secretin PilQ guiding the DNA through the OM.


Genomic Context


Location: 988508..999089
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  TT_RS11950 - 988552..988836 (-) 285 WP_226980268.1 hypothetical protein -
  TT_RS05110 (TT_C1010) - 988718..990034 (+) 1317 WP_338457458.1 HD-GYP domain-containing protein -
  TT_RS05115 (TT_C1011) - 990085..990576 (+) 492 WP_011173430.1 DUF5317 domain-containing protein -
  TT_RS05120 (TT_C1012) - 990630..991634 (+) 1005 WP_011173431.1 homoisocitrate dehydrogenase -
  TT_RS05125 (TT_C1013) pilM 991769..992902 (+) 1134 WP_011173432.1 type IV pilus assembly protein PilM Machinery gene
  TT_RS05130 (TT_C1014) pilN 992895..993518 (+) 624 WP_011173433.1 competence protein Machinery gene
  TT_RS05135 (TT_C1015) pilO 993508..994089 (+) 582 WP_011173434.1 type 4a pilus biogenesis protein PilO Machinery gene
  TT_RS05140 (TT_C1016) pilW 994086..994964 (+) 879 WP_011173435.1 hypothetical protein Machinery gene
  TT_RS05145 (TT_C1017) pilQ 994961..997234 (+) 2274 WP_011173436.1 secretin N-terminal domain-containing protein Machinery gene
  TT_RS05150 (TT_C1018) aroC 997293..998444 (+) 1152 WP_011173437.1 chorismate synthase -
  TT_RS05155 (TT_C1019) - 998469..999023 (+) 555 WP_011173438.1 shikimate kinase -

Sequence


Protein


Download         Length: 193 a.a.        Molecular weight: 21368.70 Da        Isoelectric Point: 8.4290

>NTDB_id=1025 TT_RS05135 WP_011173434.1 993508..994089(+) (pilO) [Thermus thermophilus HB27]
MLARLGQREWALLAMVLTALLGLLWYYLLIVPTRQEIATVRQEIDRLTIERNRGLQARRALPELRATIAALQAQRLAFLR
ALPREERLAEVLSEVLQDAEASGVVVRSFTRSRTSAPVPEVRAVNLALALEAPFPETYAYLRRLEDLSRFSTLSGLNLSV
QSQEANPTLATSLTLTVYVLAQGVEAETGGSTP

Nucleotide


Download         Length: 582 bp        

>NTDB_id=1025 TT_RS05135 WP_011173434.1 993508..994089(+) (pilO) [Thermus thermophilus HB27]
GTGCTCGCTAGGCTGGGACAGCGGGAGTGGGCCCTCCTGGCCATGGTCCTCACCGCCCTCCTGGGGCTCCTCTGGTACTA
CCTGCTCATCGTGCCCACGAGGCAGGAGATCGCCACCGTCCGGCAGGAGATTGACCGCCTCACCATAGAGCGCAACCGCG
GGCTCCAGGCCCGCCGGGCCCTTCCCGAGCTCCGCGCCACCATCGCCGCCCTTCAGGCCCAAAGGCTCGCCTTCCTCCGG
GCCCTGCCCCGGGAGGAAAGGCTCGCCGAGGTCCTCTCCGAGGTGCTCCAGGACGCGGAGGCGAGCGGGGTGGTGGTCCG
AAGCTTCACCCGAAGCCGCACCTCGGCCCCGGTGCCCGAGGTGCGGGCCGTGAACCTGGCCCTGGCCCTCGAGGCCCCCT
TCCCCGAAACCTACGCCTACCTGCGGCGCCTGGAGGACCTCTCCCGCTTCAGCACCCTTTCCGGCCTCAACCTGAGCGTC
CAGAGCCAGGAAGCGAACCCCACCCTCGCCACCAGCCTCACCTTGACCGTCTACGTGCTGGCCCAGGGGGTGGAGGCGGA
AACGGGAGGGAGCACCCCATGA

Domains


Predicted by InterProScan.

(41-179)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q72IW6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Deniz Yaman et al. (2024) Identification of subcomplexes and protein-protein interactions in the DNA transporter of Thermus thermophilus HB27. Biochimica Et Biophysica Acta. Biomembranes 1866(7):184363. [PMID: 38909880]
[2] Beate Averhoff et al. (2021) Natural transformation in Gram-negative bacteria thriving in extreme environments: from genes and genomes to proteins, structures and regulation. Extremophiles : Life Under Extreme Conditions 25(5-6):425-436. [PMID: 34542714]
[3] Vijaykumar Karuppiah et al. (2013) Structure and assembly of an inner membrane platform for initiation of type IV pilus biogenesis. Proceedings of The National Academy of Sciences of The United States of America 110(48):E4638-47. [PMID: 24218553]
[4] Cornelia Schwarzenlander et al. (2009) The role of single subunits of the DNA transport machinery of Thermus thermophilus HB27 in DNA binding and transport. Environmental Microbiology 11(4):801-8. [PMID: 19396940]
[5] Judit Rumszauer et al. (2006) Identification, subcellular localization and functional interactions of PilMNOWQ and PilA4 involved in transformation competency and pilus biogenesis in the thermophilic bacterium Thermus thermophilus HB27. The FEBS Journal 273(14):3261-72. [PMID: 16857013]
[6] Alexandra Friedrich et al. (2002) Molecular analyses of the natural transformation machinery and identification of pilus structures in the extremely thermophilic bacterium Thermus thermophilus strain HB27. Applied And Environmental Microbiology 68(2):745-55. [PMID: 11823215]