Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   AABK30_RS14935 Genome accession   NZ_AP027783
Coordinates   2988117..2988746 (-) Length   209 a.a.
NCBI ID   WP_000839152.1    Uniprot ID   -
Organism   Escherichia coli strain 2017-03-3CC     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2978945..3016581 2988117..2988746 within 0


Gene organization within MGE regions


Location: 2978945..3016581
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABK30_RS14885 (VEE74_28680) tusE 2979216..2979545 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  AABK30_RS14890 (VEE74_28690) yccX 2979542..2979820 (-) 279 WP_000048252.1 acylphosphatase -
  AABK30_RS14895 (VEE74_28700) rlmI 2979915..2981105 (+) 1191 WP_000116297.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  AABK30_RS14900 (VEE74_28710) hspQ 2981163..2981480 (+) 318 WP_001295356.1 heat shock protein HspQ -
  AABK30_RS14905 (VEE74_28720) yccU 2981525..2981938 (-) 414 WP_000665217.1 CoA-binding protein -
  AABK30_RS14910 (VEE74_28730) yccT 2982111..2982773 (+) 663 WP_000847785.1 DUF2057 family protein -
  AABK30_RS14915 (VEE74_28740) mgsA 2982869..2983327 (+) 459 WP_000424181.1 methylglyoxal synthase -
  AABK30_RS14920 (VEE74_28750) helD 2983359..2985413 (-) 2055 WP_087898012.1 DNA helicase IV -
  AABK30_RS14925 (VEE74_28760) yccF 2985536..2985982 (+) 447 WP_001261235.1 YccF domain-containing protein -
  AABK30_RS14930 (VEE74_28770) yccS 2985992..2988154 (+) 2163 WP_023281787.1 YccS family putative transporter -
  AABK30_RS14935 (VEE74_28780) sxy/tfoX 2988117..2988746 (-) 630 WP_000839152.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  AABK30_RS14940 (VEE74_28790) sulA 2988965..2989474 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  AABK30_RS14945 (VEE74_28810) ompA 2989831..2990871 (+) 1041 WP_000750416.1 porin OmpA -
  AABK30_RS14950 (VEE74_28820) matP 2990947..2991399 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  AABK30_RS14955 (VEE74_28830) ycbZ 2991585..2993345 (+) 1761 WP_000156518.1 Lon protease family protein -
  AABK30_RS14960 (VEE74_28840) fabA 2993414..2993932 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  AABK30_RS14965 (VEE74_28850) rmf 2994002..2994169 (-) 168 WP_000828646.1 ribosome modulation factor -
  AABK30_RS14970 (VEE74_28860) pqiC 2994425..2994988 (-) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  AABK30_RS14975 (VEE74_28870) pqiB 2994985..2996625 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  AABK30_RS14980 (VEE74_28880) pqiA 2996630..2997883 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  AABK30_RS14985 (VEE74_28890) uup 2998013..2999920 (-) 1908 WP_000053099.1 ABC transporter ATP-binding protein -
  AABK30_RS14990 (VEE74_28900) rlmKL 2999932..3002040 (-) 2109 WP_338386973.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  AABK30_RS14995 (VEE74_28910) ycbX 3002284..3003393 (+) 1110 WP_000212426.1 6-N-hydroxylaminopurine resistance protein YcbX -
  AABK30_RS15000 (VEE74_28920) zapC 3003390..3003932 (-) 543 WP_001338438.1 cell division protein ZapC -
  AABK30_RS15005 (VEE74_28930) pyrD 3004106..3005116 (-) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  AABK30_RS15010 (VEE74_28940) ycbF 3005227..3005964 (-) 738 WP_161470831.1 fimbrial chaperone -
  AABK30_RS15015 (VEE74_28950) ycbV 3005930..3006445 (-) 516 WP_210179101.1 fimbrial protein -
  AABK30_RS15020 (VEE74_28960) ycbU 3006453..3006995 (-) 543 WP_000730614.1 fimbrial protein -
  AABK30_RS15025 (VEE74_28970) elfG 3007007..3008077 (-) 1071 WP_001165668.1 fimbrial protein -
  AABK30_RS15030 (VEE74_28980) - 3008068..3009687 (-) 1620 Protein_2942 fimbrial biogenesis usher protein -
  AABK30_RS15040 (VEE74_29010) - 3011018..3012004 (-) 987 Protein_2944 fimbria/pilus outer membrane usher protein -
  AABK30_RS15045 (VEE74_29020) elfD 3012029..3012730 (-) 702 WP_016242023.1 molecular chaperone -
  AABK30_RS15050 (VEE74_29030) elfA 3012813..3013351 (-) 539 Protein_2946 fimbrial protein -
  AABK30_RS15055 (VEE74_29040) ssuE 3013707..3014282 (+) 576 WP_001263933.1 NADPH-dependent FMN reductase -
  AABK30_RS15060 (VEE74_29050) ssuA 3014275..3015234 (+) 960 WP_001244342.1 aliphatic sulfonate ABC transporter substrate-binding protein SsuA -
  AABK30_RS15065 (VEE74_29060) ssuD 3015231..3016376 (+) 1146 WP_033554501.1 FMNH2-dependent alkanesulfonate monooxygenase -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 24093.97 Da        Isoelectric Point: 8.8133

>NTDB_id=102423 AABK30_RS14935 WP_000839152.1 2988117..2988746(-) (sxy/tfoX) [Escherichia coli strain 2017-03-3CC]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVACRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=102423 AABK30_RS14935 WP_000839152.1 2988117..2988746(-) (sxy/tfoX) [Escherichia coli strain 2017-03-3CC]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCATG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995


Multiple sequence alignment