Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   AB2M35_RS16730 Genome accession   NZ_CP161902
Coordinates   3136132..3136272 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain DYJ22     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3131132..3141272
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB2M35_RS16705 (AB2M35_16705) yuxO 3131409..3131789 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  AB2M35_RS16710 (AB2M35_16710) comA 3131808..3132452 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AB2M35_RS16715 (AB2M35_16715) comP 3132533..3134845 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  AB2M35_RS16720 (AB2M35_16720) comX 3134861..3135082 (-) 222 WP_014480704.1 competence pheromone ComX -
  AB2M35_RS16725 (AB2M35_16725) - 3135084..3135947 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  AB2M35_RS16730 (AB2M35_16730) degQ 3136132..3136272 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AB2M35_RS16735 (AB2M35_16735) - 3136494..3136619 (+) 126 WP_003228793.1 hypothetical protein -
  AB2M35_RS16740 (AB2M35_16740) - 3136734..3137102 (+) 369 WP_046381300.1 hypothetical protein -
  AB2M35_RS16745 (AB2M35_16745) pdeH 3137078..3138307 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  AB2M35_RS16750 (AB2M35_16750) pncB 3138443..3139915 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AB2M35_RS16755 (AB2M35_16755) pncA 3139931..3140482 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  AB2M35_RS16760 (AB2M35_16760) yueI 3140579..3140977 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1023017 AB2M35_RS16730 WP_003220708.1 3136132..3136272(-) (degQ) [Bacillus subtilis strain DYJ22]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1023017 AB2M35_RS16730 WP_003220708.1 3136132..3136272(-) (degQ) [Bacillus subtilis strain DYJ22]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment