Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   STAB902_RS00610 Genome accession   NZ_CP007041
Coordinates   99001..99285 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes STAB902     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 94001..104285
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  STAB902_RS00585 (STAB902_00610) - 95947..96312 (+) 366 WP_002986560.1 DUF1033 family protein -
  STAB902_RS00590 (STAB902_00615) comGA 96405..97343 (+) 939 WP_011054114.1 competence type IV pilus ATPase ComGA Machinery gene
  STAB902_RS00595 (STAB902_00620) comGB 97279..98313 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  STAB902_RS00600 (STAB902_00625) comGC 98315..98641 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  STAB902_RS00605 (STAB902_00630) comGD 98616..99044 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  STAB902_RS00610 (STAB902_00635) comGE 99001..99285 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  STAB902_RS00615 (STAB902_00640) comGF 99278..99712 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  STAB902_RS00620 (STAB902_00645) comGG 99696..100022 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  STAB902_RS00625 (STAB902_00650) comGH 100120..101073 (+) 954 WP_011054117.1 class I SAM-dependent methyltransferase Machinery gene
  STAB902_RS00630 (STAB902_00655) - 101132..102328 (+) 1197 WP_010921803.1 acetate kinase -
  STAB902_RS00635 (STAB902_00660) - 102529..102837 (+) 309 WP_011054118.1 hypothetical protein -
  STAB902_RS00640 (STAB902_00665) proC 102920..103690 (-) 771 WP_002992745.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=102236 STAB902_RS00610 WP_002987779.1 99001..99285(+) (comGE) [Streptococcus pyogenes STAB902]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=102236 STAB902_RS00610 WP_002987779.1 99001..99285(+) (comGE) [Streptococcus pyogenes STAB902]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTGAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383