Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   SMUFR_RS02040 Genome accession   NZ_CP007016
Coordinates   396415..396645 (+) Length   76 a.a.
NCBI ID   WP_002275977.1    Uniprot ID   Q8DVP7
Organism   Streptococcus mutans UA159-FR     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 391415..401645
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SMUFR_RS02020 (SMUFR_0360) rnpM 391984..392280 (+) 297 WP_002263922.1 RNase P modulator RnpM -
  SMUFR_RS02025 (SMUFR_0361) - 392273..392575 (+) 303 WP_002262601.1 YlxQ-related RNA-binding protein -
  SMUFR_RS11015 - 392596..392691 (+) 96 Protein_373 translation initiation factor IF-2 N-terminal domain-containing protein -
  SMUFR_RS02030 (SMUFR_0362) infB 393124..395346 (+) 2223 Protein_374 translation initiation factor IF-2 -
  SMUFR_RS02035 (SMUFR_0363) rbfA 395580..395930 (+) 351 WP_002262599.1 30S ribosome-binding factor RbfA -
  SMUFR_RS02040 (SMUFR_0364) cipB 396415..396645 (+) 231 WP_002275977.1 bacteriocin class II family protein Regulator
  SMUFR_RS02045 (SMUFR_0365) - 397036..397479 (+) 444 WP_002263708.1 CopY/TcrY family copper transport repressor -
  SMUFR_RS02050 (SMUFR_0366) - 397476..399704 (+) 2229 WP_002263707.1 heavy metal translocating P-type ATPase -
  SMUFR_RS02055 (SMUFR_0367) copZ 399717..399920 (+) 204 WP_002263706.1 copper chaperone CopZ -
  SMUFR_RS02060 (SMUFR_0368) - 400167..400988 (+) 822 WP_032497569.1 Cof-type HAD-IIB family hydrolase -
  SMUFR_RS02065 (SMUFR_0369) - 401095..401586 (-) 492 WP_011074508.1 YgjV family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7229.19 Da        Isoelectric Point: 3.7781

>NTDB_id=102123 SMUFR_RS02040 WP_002275977.1 396415..396645(+) (cipB) [Streptococcus mutans UA159-FR]
MNTQAFEQFNVMDNEALSTVEGGGMIRCALGTAGSAGLGFVGGMGAGTVTLPVVGTVSGAALGGWSGAAVGAATFC

Nucleotide


Download         Length: 231 bp        

>NTDB_id=102123 SMUFR_RS02040 WP_002275977.1 396415..396645(+) (cipB) [Streptococcus mutans UA159-FR]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAACTGTTGAGGGTGGTGGTATGATTAG
ATGTGCACTTGGCACAGCTGGTTCTGCAGGTTTAGGATTTGTAGGGGGTATGGGAGCTGGTACAGTTACTCTCCCAGTCG
TTGGTACAGTATCTGGAGCGGCTTTAGGAGGCTGGTCTGGAGCAGCTGTAGGTGCTGCTACTTTTTGTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DVP7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

71.429

55.263

0.395


Multiple sequence alignment