Detailed information    

insolico Bioinformatically predicted

Overview

Name   HI0659   Type   Machinery gene
Locus tag   ABZ559_RS06445 Genome accession   NZ_CP160400
Coordinates   1240448..1240741 (+) Length   97 a.a.
NCBI ID   WP_367007586.1    Uniprot ID   -
Organism   Streptococcus sp. ZY19097     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1228395..1249348 1240448..1240741 within 0


Gene organization within MGE regions


Location: 1228395..1249348
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABZ559_RS06335 (ABZ559_06335) - 1228395..1228817 (-) 423 WP_317335253.1 DUF6556 family protein -
  ABZ559_RS06340 (ABZ559_06340) - 1229089..1230252 (-) 1164 WP_367007568.1 site-specific integrase -
  ABZ559_RS06345 (ABZ559_06345) - 1230346..1230891 (-) 546 WP_367007569.1 helix-turn-helix transcriptional regulator -
  ABZ559_RS06350 (ABZ559_06350) - 1231034..1231219 (+) 186 WP_367007570.1 hypothetical protein -
  ABZ559_RS06355 (ABZ559_06355) - 1231268..1231420 (+) 153 WP_367007571.1 hypothetical protein -
  ABZ559_RS06360 (ABZ559_06360) - 1231793..1232995 (+) 1203 WP_367006366.1 IS110 family transposase -
  ABZ559_RS06365 (ABZ559_06365) - 1233335..1233532 (+) 198 WP_367007572.1 hypothetical protein -
  ABZ559_RS06370 (ABZ559_06370) - 1233536..1233742 (+) 207 WP_367007573.1 hypothetical protein -
  ABZ559_RS06375 (ABZ559_06375) - 1233752..1234018 (+) 267 WP_367007574.1 HTH domain-containing protein -
  ABZ559_RS06380 (ABZ559_06380) - 1234029..1234187 (+) 159 WP_367007575.1 hypothetical protein -
  ABZ559_RS06385 (ABZ559_06385) - 1234193..1234357 (+) 165 WP_367007576.1 hypothetical protein -
  ABZ559_RS06390 (ABZ559_06390) - 1234341..1234862 (+) 522 WP_367007577.1 hypothetical protein -
  ABZ559_RS06395 (ABZ559_06395) - 1234863..1236272 (+) 1410 WP_367007578.1 VapE domain-containing protein -
  ABZ559_RS06400 (ABZ559_06400) - 1236693..1236887 (+) 195 WP_367007579.1 hypothetical protein -
  ABZ559_RS06405 (ABZ559_06405) - 1237114..1237296 (+) 183 WP_367007580.1 hypothetical protein -
  ABZ559_RS06410 (ABZ559_06410) - 1237393..1237971 (+) 579 WP_367007581.1 hypothetical protein -
  ABZ559_RS06415 (ABZ559_06415) - 1237968..1238255 (+) 288 WP_367007582.1 hypothetical protein -
  ABZ559_RS06420 (ABZ559_06420) - 1238293..1238688 (+) 396 WP_027971718.1 hypothetical protein -
  ABZ559_RS06425 (ABZ559_06425) - 1238729..1239040 (+) 312 WP_367007583.1 hypothetical protein -
  ABZ559_RS06430 (ABZ559_06430) - 1239055..1239468 (+) 414 WP_367007584.1 hypothetical protein -
  ABZ559_RS06435 (ABZ559_06435) - 1239470..1239886 (+) 417 WP_171841004.1 minor capsid protein -
  ABZ559_RS06440 (ABZ559_06440) - 1240093..1240458 (+) 366 WP_367007585.1 type II toxin-antitoxin system RelE/ParE family toxin -
  ABZ559_RS06445 (ABZ559_06445) HI0659 1240448..1240741 (+) 294 WP_367007586.1 helix-turn-helix transcriptional regulator Machinery gene
  ABZ559_RS06450 (ABZ559_06450) - 1240961..1242106 (+) 1146 WP_273403309.1 cysteine desulfurase family protein -
  ABZ559_RS06455 (ABZ559_06455) thiI 1242392..1243612 (+) 1221 WP_367007587.1 tRNA uracil 4-sulfurtransferase ThiI -
  ABZ559_RS06460 (ABZ559_06460) - 1244031..1244411 (+) 381 WP_273403316.1 RidA family protein -
  ABZ559_RS06465 (ABZ559_06465) - 1246406..1246627 (+) 222 WP_367007589.1 lactococcin 972 family bacteriocin -
  ABZ559_RS06470 (ABZ559_06470) - 1246699..1248717 (+) 2019 WP_367007591.1 DUF1430 domain-containing protein -
  ABZ559_RS06475 (ABZ559_06475) - 1248719..1249348 (+) 630 WP_273403324.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 97 a.a.        Molecular weight: 10723.39 Da        Isoelectric Point: 5.1991

>NTDB_id=1020934 ABZ559_RS06445 WP_367007586.1 1240448..1240741(+) (HI0659) [Streptococcus sp. ZY19097]
MKNNAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPLEHEQA

Nucleotide


Download         Length: 294 bp        

>NTDB_id=1020934 ABZ559_RS06445 WP_367007586.1 1240448..1240741(+) (HI0659) [Streptococcus sp. ZY19097]
ATGAAAAATAATGCTATTGGTAGTAACTGGAAAGATGTAAGAGCTGAATTATTCAGCAAAGAGGAAATTTTGGAAAGTGA
TATGCGCGTGGCTATCATGAGTGAGCTTATCGAGGCTAGAAATGAAAAGGGCATTAGTCAGAAGAAACTAGAGGAGATGA
GCGGTGTTAGTCAGCCAGTTATCGCTAGAATGGAAACAGGAAAGACAAGCCCGCAACTTGATACAGTATTAAAAGTATTG
GCAAGTCTTGGTAAGACCTTAGCCGTTGTTCCTTTGGAGCATGAACAAGCATAA

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(37-88)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

55.208

98.969

0.546

Multiple sequence alignment