Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   AB1F75_RS04950 Genome accession   NZ_CP160396
Coordinates   970968..971135 (+) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis subsp. subtilis strain BSP1     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 965968..976135
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB1F75_RS04920 (AB1F75_04920) pncB 966113..967585 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  AB1F75_RS04925 (AB1F75_04925) pdeH 967722..968951 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  AB1F75_RS04930 (AB1F75_04930) - 968927..969295 (-) 369 WP_014477834.1 hypothetical protein -
  AB1F75_RS04935 (AB1F75_04935) - 969409..969534 (-) 126 WP_003228793.1 hypothetical protein -
  AB1F75_RS04940 (AB1F75_04940) degQ 969756..969896 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  AB1F75_RS04945 (AB1F75_04945) comQ 970081..970980 (+) 900 WP_015251332.1 ComX modifying isoprenyl transferase ComQ Regulator
  AB1F75_RS04950 (AB1F75_04950) comX 970968..971135 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  AB1F75_RS04955 (AB1F75_04955) comP 971150..973459 (+) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  AB1F75_RS04960 (AB1F75_04960) comA 973540..974184 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  AB1F75_RS04965 (AB1F75_04965) yuxO 974203..974583 (+) 381 WP_017695528.1 hotdog fold thioesterase -
  AB1F75_RS04970 (AB1F75_04970) mnhG 974624..974998 (-) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  AB1F75_RS04975 (AB1F75_04975) mrpF 974982..975266 (-) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  AB1F75_RS04980 (AB1F75_04980) mrpE 975266..975742 (-) 477 WP_003228815.1 Na+/H+ antiporter subunit E -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=1020786 AB1F75_RS04950 WP_003242801.1 970968..971135(+) (comX) [Bacillus subtilis subsp. subtilis strain BSP1]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1020786 AB1F75_RS04950 WP_003242801.1 970968..971135(+) (comX) [Bacillus subtilis subsp. subtilis strain BSP1]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTTCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment