Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   AB0R67_RS12860 Genome accession   NZ_CP160237
Coordinates   2525496..2525774 (+) Length   92 a.a.
NCBI ID   WP_016512773.1    Uniprot ID   -
Organism   Bacillus thuringiensis strain JJ1216     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2514306..2555006 2525496..2525774 within 0


Gene organization within MGE regions


Location: 2514306..2555006
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R67_RS12770 (AB0R67_12775) - 2514306..2514569 (+) 264 WP_002082716.1 DUF3937 domain-containing protein -
  AB0R67_RS12775 (AB0R67_12780) - 2515119..2515439 (+) 321 WP_001071363.1 heterocycloanthracin/sonorensin family bacteriocin -
  AB0R67_RS12780 (AB0R67_12785) - 2515589..2515723 (+) 135 Protein_2436 site-specific integrase -
  AB0R67_RS12785 (AB0R67_12790) - 2515933..2516418 (+) 486 WP_002041181.1 hypothetical protein -
  AB0R67_RS12790 (AB0R67_12795) - 2516730..2517428 (+) 699 Protein_2438 DUF3962 domain-containing protein -
  AB0R67_RS12795 (AB0R67_12800) - 2517470..2518579 (-) 1110 WP_097924125.1 tyrosine-type recombinase/integrase -
  AB0R67_RS12800 (AB0R67_12805) - 2518883..2520112 (+) 1230 WP_366559559.1 exosporium leader peptide-containing protein -
  AB0R67_RS12805 (AB0R67_12810) - 2520730..2521827 (+) 1098 WP_097820541.1 AimR family lysis-lysogeny pheromone receptor -
  AB0R67_RS12810 (AB0R67_12815) - 2521840..2521989 (+) 150 WP_167754516.1 hypothetical protein -
  AB0R67_RS12815 (AB0R67_12820) - 2522110..2522250 (+) 141 WP_000527328.1 hypothetical protein -
  AB0R67_RS12820 (AB0R67_12825) - 2522270..2522608 (-) 339 WP_048567701.1 helix-turn-helix transcriptional regulator -
  AB0R67_RS12825 (AB0R67_12830) - 2522780..2522986 (+) 207 WP_000242167.1 helix-turn-helix transcriptional regulator -
  AB0R67_RS12830 (AB0R67_12835) - 2523108..2523374 (+) 267 WP_000522017.1 helix-turn-helix domain-containing protein -
  AB0R67_RS12835 (AB0R67_12840) - 2523374..2523538 (+) 165 WP_048567699.1 hypothetical protein -
  AB0R67_RS12840 (AB0R67_12845) - 2523568..2523744 (+) 177 WP_048567698.1 hypothetical protein -
  AB0R67_RS12845 (AB0R67_12850) - 2523749..2524471 (+) 723 WP_048567697.1 DnaD domain protein -
  AB0R67_RS12850 (AB0R67_12855) - 2524419..2525282 (+) 864 WP_097925509.1 ATP-binding protein -
  AB0R67_RS12855 (AB0R67_12860) - 2525285..2525479 (+) 195 WP_048567695.1 hypothetical protein -
  AB0R67_RS12860 (AB0R67_12865) abrB 2525496..2525774 (+) 279 WP_016512773.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  AB0R67_RS12865 (AB0R67_12870) - 2525767..2526126 (+) 360 WP_016512772.1 hypothetical protein -
  AB0R67_RS12870 (AB0R67_12875) - 2526145..2526312 (+) 168 WP_000717826.1 DUF3954 domain-containing protein -
  AB0R67_RS12875 (AB0R67_12880) - 2526338..2526589 (+) 252 WP_097925507.1 helix-turn-helix domain containing protein -
  AB0R67_RS12880 (AB0R67_12885) - 2526609..2527091 (+) 483 WP_097925505.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  AB0R67_RS12885 (AB0R67_12890) - 2527332..2528747 (+) 1416 WP_335446436.1 collagen-like protein -
  AB0R67_RS12890 (AB0R67_12895) - 2529525..2529773 (+) 249 Protein_2458 hypothetical protein -
  AB0R67_RS12895 (AB0R67_12900) - 2529883..2530338 (-) 456 WP_000053893.1 helix-turn-helix domain-containing protein -
  AB0R67_RS12900 (AB0R67_12905) - 2530728..2532086 (-) 1359 WP_366559560.1 collagen-like protein -
  AB0R67_RS12905 (AB0R67_12910) - 2533045..2533335 (-) 291 WP_097923805.1 hypothetical protein -
  AB0R67_RS12910 (AB0R67_12915) - 2533562..2533732 (+) 171 WP_097923807.1 hypothetical protein -
  AB0R67_RS12915 (AB0R67_12920) - 2533760..2534242 (+) 483 WP_072938528.1 ArpU family phage packaging/lysis transcriptional regulator -
  AB0R67_RS12920 (AB0R67_12925) - 2534242..2534784 (+) 543 WP_047386214.1 site-specific integrase -
  AB0R67_RS12925 (AB0R67_12930) - 2534999..2535949 (+) 951 WP_044307557.1 nucleoside hydrolase -
  AB0R67_RS12930 (AB0R67_12935) - 2536306..2537076 (+) 771 WP_097923809.1 hypothetical protein -
  AB0R67_RS12935 (AB0R67_12940) - 2537455..2537604 (+) 150 WP_157418283.1 hypothetical protein -
  AB0R67_RS12940 (AB0R67_12945) - 2537608..2537934 (+) 327 WP_076872697.1 HNH endonuclease signature motif containing protein -
  AB0R67_RS12945 (AB0R67_12950) - 2537937..2538233 (+) 297 WP_097923811.1 hypothetical protein -
  AB0R67_RS12950 (AB0R67_12955) - 2538541..2539038 (+) 498 WP_000015467.1 P27 family phage terminase small subunit -
  AB0R67_RS12955 (AB0R67_12960) - 2539013..2540689 (+) 1677 WP_366559561.1 terminase TerL endonuclease subunit -
  AB0R67_RS12960 (AB0R67_12965) - 2540706..2541950 (+) 1245 WP_097923813.1 phage portal protein -
  AB0R67_RS12965 (AB0R67_12970) - 2541967..2542599 (+) 633 WP_097924024.1 head maturation protease, ClpP-related -
  AB0R67_RS12970 (AB0R67_12975) - 2542613..2543737 (+) 1125 WP_335446238.1 phage major capsid protein -
  AB0R67_RS12975 (AB0R67_12980) - 2543751..2544074 (+) 324 WP_097846710.1 hypothetical protein -
  AB0R67_RS12980 (AB0R67_12985) - 2544064..2544420 (+) 357 WP_000963758.1 hypothetical protein -
  AB0R67_RS12985 (AB0R67_12990) - 2544407..2544787 (+) 381 WP_016512759.1 hypothetical protein -
  AB0R67_RS12990 (AB0R67_12995) - 2544777..2545187 (+) 411 WP_001111193.1 hypothetical protein -
  AB0R67_RS12995 (AB0R67_13000) - 2545189..2545758 (+) 570 WP_097923814.1 phage tail protein -
  AB0R67_RS13000 (AB0R67_13005) - 2545820..2546170 (+) 351 WP_000159510.1 hypothetical protein -
  AB0R67_RS13005 (AB0R67_13010) - 2546353..2550201 (+) 3849 WP_366559562.1 phage tail tape measure protein -
  AB0R67_RS13010 (AB0R67_13015) - 2550194..2550880 (+) 687 WP_097923818.1 phage tail domain-containing protein -
  AB0R67_RS13015 (AB0R67_13020) - 2550877..2553606 (+) 2730 WP_097923820.1 phage tail spike protein -
  AB0R67_RS13020 (AB0R67_13025) - 2553646..2554071 (+) 426 WP_097923822.1 phage holin family protein -
  AB0R67_RS13025 (AB0R67_13030) - 2554071..2555006 (+) 936 WP_097923823.1 N-acetylmuramoyl-L-alanine amidase -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10158.75 Da        Isoelectric Point: 6.2246

>NTDB_id=1020380 AB0R67_RS12860 WP_016512773.1 2525496..2525774(+) (abrB) [Bacillus thuringiensis strain JJ1216]
MKNTGVARKVDELGRVVIPVELRRTLGITEGTALDFHVDGENIVLRRHEKSCFVTGEVSENNIELLGGRMFLSKEGVIEL
LDLIQKSGMAHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=1020380 AB0R67_RS12860 WP_016512773.1 2525496..2525774(+) (abrB) [Bacillus thuringiensis strain JJ1216]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
TATTACCGAAGGAACGGCACTAGATTTTCATGTCGATGGTGAAAACATCGTTTTAAGAAGACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAAACAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGTAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-47)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

57.471

94.565

0.543

Multiple sequence alignment