Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   BAMY6614_RS17875 Genome accession   NZ_CP006960
Coordinates   3731117..3731293 (-) Length   58 a.a.
NCBI ID   WP_007408675.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens UMAF6614     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3726117..3736293
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMY6614_RS17845 (BAMY6614_18875) - 3726500..3726976 (+) 477 WP_007408672.1 Na+/H+ antiporter subunit E -
  BAMY6614_RS17850 (BAMY6614_18880) - 3726976..3727260 (+) 285 WP_012118311.1 Na(+)/H(+) antiporter subunit F1 -
  BAMY6614_RS17855 (BAMY6614_18885) mnhG 3727244..3727618 (+) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  BAMY6614_RS17860 (BAMY6614_18890) - 3727658..3728041 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  BAMY6614_RS17865 (BAMY6614_18895) comA 3728063..3728707 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BAMY6614_RS17870 (BAMY6614_18900) comP 3728788..3731097 (-) 2310 WP_061862531.1 sensor histidine kinase Regulator
  BAMY6614_RS17875 (BAMY6614_18905) comX 3731117..3731293 (-) 177 WP_007408675.1 competence pheromone ComX Regulator
  BAMY6614_RS17880 (BAMY6614_18910) comQ 3731293..3732231 (-) 939 WP_269465507.1 polyprenyl synthetase family protein Regulator
  BAMY6614_RS17885 (BAMY6614_18915) degQ 3732362..3732502 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BAMY6614_RS17890 (BAMY6614_18920) - 3732968..3733309 (+) 342 WP_061862532.1 hypothetical protein -
  BAMY6614_RS17895 (BAMY6614_18925) - 3733316..3734539 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  BAMY6614_RS17900 (BAMY6614_18930) - 3734669..3736135 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6644.64 Da        Isoelectric Point: 4.6082

>NTDB_id=102005 BAMY6614_RS17875 WP_007408675.1 3731117..3731293(-) (comX) [Bacillus amyloliquefaciens UMAF6614]
MQDLINYILKYPEVLKKLKVNEASLLGYDSGITQILINSFEESSIVKNDGKIEQWEKG

Nucleotide


Download         Length: 177 bp        

>NTDB_id=102005 BAMY6614_RS17875 WP_007408675.1 3731117..3731293(-) (comX) [Bacillus amyloliquefaciens UMAF6614]
ATGCAGGATTTAATCAATTATATATTGAAATATCCGGAAGTGTTAAAAAAATTAAAAGTCAATGAAGCAAGTTTATTAGG
CTATGATTCAGGTATTACCCAAATATTAATCAATTCATTTGAAGAATCTTCAATTGTGAAAAACGATGGAAAAATAGAGC
AATGGGAAAAAGGATGA

Domains

Predicted by InterProScan.

Bacillus competence pheromone ComX (ComX)

(1-55)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

47.273

94.828

0.448

Multiple sequence alignment