Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB0R65_RS15080 Genome accession   NZ_CP160225
Coordinates   3053758..3053898 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JJ1284     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3048758..3058898
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R65_RS15055 (AB0R65_15055) - 3049085..3049468 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  AB0R65_RS15060 (AB0R65_15060) comA 3049490..3050134 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AB0R65_RS15065 (AB0R65_15065) comP 3050215..3052521 (-) 2307 WP_015240483.1 sensor histidine kinase Regulator
  AB0R65_RS15070 (AB0R65_15070) comX 3052540..3052716 (-) 177 WP_015240484.1 competence pheromone ComX -
  AB0R65_RS15075 (AB0R65_15075) - 3052731..3053606 (-) 876 WP_025285191.1 polyprenyl synthetase family protein -
  AB0R65_RS15080 (AB0R65_15080) degQ 3053758..3053898 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AB0R65_RS15085 (AB0R65_15085) - 3054363..3054704 (+) 342 WP_167340838.1 hypothetical protein -
  AB0R65_RS15090 (AB0R65_15090) - 3054711..3055934 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  AB0R65_RS15095 (AB0R65_15095) - 3056064..3057530 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  AB0R65_RS15100 (AB0R65_15100) - 3057548..3058099 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  AB0R65_RS15105 (AB0R65_15105) - 3058196..3058594 (-) 399 WP_015240486.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1020007 AB0R65_RS15080 WP_003152043.1 3053758..3053898(-) (degQ) [Bacillus velezensis strain JJ1284]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1020007 AB0R65_RS15080 WP_003152043.1 3053758..3053898(-) (degQ) [Bacillus velezensis strain JJ1284]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment