Detailed information NTG1019854

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AB0R64_RS11725
• Genome accession: NZ_CP160223
• Coordinates: 2440327..2440764 (-)
• Length: 145 a.a.
• NCBI ID: WP_007612572.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain JJ951
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2435327..2445764

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB0R64_RS11675 (AB0R64_11675)	sinI	2435710..2435883 (+)	174	WP_032874029.1	anti-repressor SinI	Regulator
AB0R64_RS11680 (AB0R64_11680)	sinR	2435917..2436252 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
AB0R64_RS11685 (AB0R64_11685)	tasA	2436300..2437085 (-)	786	WP_032874027.1	biofilm matrix protein TasA	-
AB0R64_RS11690 (AB0R64_11690)	sipW	2437150..2437734 (-)	585	WP_032874025.1	signal peptidase I SipW	-
AB0R64_RS11695 (AB0R64_11695)	tapA	2437706..2438377 (-)	672	WP_032874023.1	amyloid fiber anchoring/assembly protein TapA	-
AB0R64_RS11700 (AB0R64_11700)	-	2438636..2438965 (+)	330	WP_032874021.1	DUF3889 domain-containing protein	-
AB0R64_RS11705 (AB0R64_11705)	-	2439006..2439185 (-)	180	WP_022552966.1	YqzE family protein	-
AB0R64_RS11710 (AB0R64_11710)	comGG	2439242..2439619 (-)	378	WP_032874019.1	competence type IV pilus minor pilin ComGG	Machinery gene
AB0R64_RS11715 (AB0R64_11715)	comGF	2439620..2440120 (-)	501	WP_223204419.1	competence type IV pilus minor pilin ComGF	-
AB0R64_RS11720 (AB0R64_11720)	comGE	2440029..2440343 (-)	315	WP_032874016.1	competence type IV pilus minor pilin ComGE	Machinery gene
AB0R64_RS11725 (AB0R64_11725)	comGD	2440327..2440764 (-)	438	WP_007612572.1	competence type IV pilus minor pilin ComGD	Machinery gene
AB0R64_RS11730 (AB0R64_11730)	comGC	2440754..2441062 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
AB0R64_RS11735 (AB0R64_11735)	comGB	2441067..2442104 (-)	1038	WP_032874014.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB0R64_RS11740 (AB0R64_11740)	comGA	2442091..2443161 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
AB0R64_RS11745 (AB0R64_11745)	-	2443358..2444308 (-)	951	WP_032874012.1	magnesium transporter CorA family protein	-
AB0R64_RS11750 (AB0R64_11750)	-	2444454..2445755 (+)	1302	WP_032874010.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16254.76 Da
• Isoelectric Point: 10.1850

>NTDB_id=1019854 AB0R64_RS11725 WP_007612572.1 2440327..2440764(-) (comGD) [Bacillus velezensis strain JJ951]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1019854 AB0R64_RS11725 WP_007612572.1 2440327..2440764(-) (comGD) [Bacillus velezensis strain JJ951]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	55.479	100	0.559