Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BAMY6614_RS14930 Genome accession   NZ_CP006960
Coordinates   3163733..3163906 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens UMAF6614     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3158733..3168906
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMY6614_RS14915 (BAMY6614_15760) gcvT 3159546..3160646 (-) 1101 WP_061862388.1 glycine cleavage system aminomethyltransferase GcvT -
  BAMY6614_RS14920 (BAMY6614_15765) - 3161070..3162740 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  BAMY6614_RS14925 (BAMY6614_15770) - 3162762..3163556 (+) 795 WP_014418368.1 YqhG family protein -
  BAMY6614_RS14930 (BAMY6614_15775) sinI 3163733..3163906 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  BAMY6614_RS14935 (BAMY6614_15780) sinR 3163940..3164275 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAMY6614_RS14940 (BAMY6614_15785) tasA 3164323..3165108 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BAMY6614_RS14945 (BAMY6614_15790) sipW 3165173..3165757 (-) 585 WP_014418370.1 signal peptidase I SipW -
  BAMY6614_RS14950 (BAMY6614_15795) tapA 3165729..3166400 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  BAMY6614_RS14955 (BAMY6614_15800) - 3166659..3166988 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BAMY6614_RS14960 (BAMY6614_15805) - 3167029..3167208 (-) 180 WP_003153093.1 YqzE family protein -
  BAMY6614_RS14965 (BAMY6614_15810) comGG 3167265..3167642 (-) 378 WP_061862389.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAMY6614_RS14970 (BAMY6614_15815) comGF 3167643..3168038 (-) 396 WP_061862390.1 competence type IV pilus minor pilin ComGF Machinery gene
  BAMY6614_RS14975 (BAMY6614_15820) comGE 3168052..3168366 (-) 315 WP_061862391.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAMY6614_RS14980 (BAMY6614_15825) comGD 3168350..3168787 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=101974 BAMY6614_RS14930 WP_014418369.1 3163733..3163906(+) (sinI) [Bacillus amyloliquefaciens UMAF6614]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=101974 BAMY6614_RS14930 WP_014418369.1 3163733..3163906(+) (sinI) [Bacillus amyloliquefaciens UMAF6614]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment