Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BAMY6614_RS14930 | Genome accession | NZ_CP006960 |
| Coordinates | 3163733..3163906 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | - |
| Organism | Bacillus amyloliquefaciens UMAF6614 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3158733..3168906
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAMY6614_RS14915 (BAMY6614_15760) | gcvT | 3159546..3160646 (-) | 1101 | WP_061862388.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BAMY6614_RS14920 (BAMY6614_15765) | - | 3161070..3162740 (+) | 1671 | WP_021494309.1 | DEAD/DEAH box helicase | - |
| BAMY6614_RS14925 (BAMY6614_15770) | - | 3162762..3163556 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| BAMY6614_RS14930 (BAMY6614_15775) | sinI | 3163733..3163906 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| BAMY6614_RS14935 (BAMY6614_15780) | sinR | 3163940..3164275 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BAMY6614_RS14940 (BAMY6614_15785) | tasA | 3164323..3165108 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| BAMY6614_RS14945 (BAMY6614_15790) | sipW | 3165173..3165757 (-) | 585 | WP_014418370.1 | signal peptidase I SipW | - |
| BAMY6614_RS14950 (BAMY6614_15795) | tapA | 3165729..3166400 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BAMY6614_RS14955 (BAMY6614_15800) | - | 3166659..3166988 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| BAMY6614_RS14960 (BAMY6614_15805) | - | 3167029..3167208 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BAMY6614_RS14965 (BAMY6614_15810) | comGG | 3167265..3167642 (-) | 378 | WP_061862389.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BAMY6614_RS14970 (BAMY6614_15815) | comGF | 3167643..3168038 (-) | 396 | WP_061862390.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| BAMY6614_RS14975 (BAMY6614_15820) | comGE | 3168052..3168366 (-) | 315 | WP_061862391.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BAMY6614_RS14980 (BAMY6614_15825) | comGD | 3168350..3168787 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=101974 BAMY6614_RS14930 WP_014418369.1 3163733..3163906(+) (sinI) [Bacillus amyloliquefaciens UMAF6614]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=101974 BAMY6614_RS14930 WP_014418369.1 3163733..3163906(+) (sinI) [Bacillus amyloliquefaciens UMAF6614]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |