Detailed information    

insolico Bioinformatically predicted

Overview

Name   comE/blpR   Type   Regulator
Locus tag   DQL37_RS09830 Genome accession   NZ_LS483352
Coordinates   390259..390477 (+) Length   72 a.a.
NCBI ID   WP_072135532.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain NCTC12052     
Function   activate transcription of early competence genes; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 385259..395477
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  DQL37_RS02115 (NCTC12052_00416) - 386266..386841 (+) 576 WP_009880369.1 uracil-DNA glycosylase family protein -
  DQL37_RS02120 (NCTC12052_00417) ybeY 387000..387497 (+) 498 WP_032467023.1 rRNA maturation RNase YbeY -
  DQL37_RS02125 (NCTC12052_00418) - 387478..387885 (+) 408 WP_002985746.1 diacylglycerol kinase family protein -
  DQL37_RS02130 (NCTC12052_00419) era 388005..388901 (+) 897 WP_002985743.1 GTPase Era -
  DQL37_RS02135 (NCTC12052_00420) - 388922..389398 (+) 477 WP_002993018.1 NUDIX hydrolase -
  DQL37_RS09825 - 389704..389958 (-) 255 WP_014407373.1 hypothetical protein -
  DQL37_RS09830 comE/blpR 390259..390477 (+) 219 WP_072135532.1 LytTR family transcriptional regulator DNA-binding domain-containing protein Regulator
  DQL37_RS09835 - 390674..392280 (-) 1607 Protein_369 ABC transporter transmembrane domain-containing protein -
  DQL37_RS02165 (NCTC12052_00425) - 392578..392802 (+) 225 WP_002994580.1 Blp family class II bacteriocin -
  DQL37_RS09675 (NCTC12052_00426) - 392780..392956 (+) 177 WP_002994581.1 hypothetical protein -
  DQL37_RS10065 - 393280..393561 (+) 282 WP_151412331.1 CPBP family intramembrane glutamic endopeptidase -
  DQL37_RS09950 - 393646..393774 (+) 129 WP_002994583.1 hypothetical protein -
  DQL37_RS02180 (NCTC12052_00428) - 394172..394399 (+) 228 WP_028797129.1 Blp family class II bacteriocin -
  DQL37_RS02185 (NCTC12052_00429) - 394448..394765 (+) 318 WP_002994587.1 hypothetical protein -

Sequence

Protein


Download         Length: 72 a.a.        Molecular weight: 8666.13 Da        Isoelectric Point: 10.5045

>NTDB_id=1019738 DQL37_RS09830 WP_072135532.1 390259..390477(+) (comE/blpR) [Streptococcus pyogenes strain NCTC12052]
MVLYSTRERIEFYGELSEIVKQEPRLFQCHRSFVVNPYNISSIQRLERKVYLKKRFILSSIKAKSYCSKRSS

Nucleotide


Download         Length: 219 bp        

>NTDB_id=1019738 DQL37_RS09830 WP_072135532.1 390259..390477(+) (comE/blpR) [Streptococcus pyogenes strain NCTC12052]
TTGGTTCTTTATTCTACTAGAGAAAGGATTGAATTTTATGGGGAGTTATCTGAAATCGTTAAGCAAGAACCAAGATTATT
TCAATGCCATCGATCATTTGTTGTTAATCCCTACAATATATCTTCAATACAACGATTAGAACGTAAGGTTTATTTAAAAA
AACGGTTCATCTTGTCTAGTATCAAGGCTAAAAGTTACTGCTCTAAAAGAAGCAGTTGA

Domains

Predicted by InterProScan.

LytTr DNA-binding domain (LytTR)

(3-55)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE/blpR Streptococcus mutans UA159

56.604

73.611

0.417

Multiple sequence alignment