Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | AB0R89_RS14990 | Genome accession | NZ_CP160218 |
| Coordinates | 3105153..3105293 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain AP45 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3100153..3110293
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R89_RS14965 (AB0R89_14965) | - | 3100480..3100863 (-) | 384 | WP_012118312.1 | hotdog fold thioesterase | - |
| AB0R89_RS14970 (AB0R89_14970) | comA | 3100885..3101529 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| AB0R89_RS14975 (AB0R89_14975) | comP | 3101610..3103916 (-) | 2307 | WP_015240483.1 | sensor histidine kinase | Regulator |
| AB0R89_RS14980 (AB0R89_14980) | comX | 3103935..3104111 (-) | 177 | WP_015240484.1 | competence pheromone ComX | - |
| AB0R89_RS14985 (AB0R89_14985) | - | 3104126..3105001 (-) | 876 | WP_025285191.1 | polyprenyl synthetase family protein | - |
| AB0R89_RS14990 (AB0R89_14990) | degQ | 3105153..3105293 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| AB0R89_RS14995 (AB0R89_14995) | - | 3105758..3106099 (+) | 342 | WP_043020756.1 | hypothetical protein | - |
| AB0R89_RS15000 (AB0R89_15000) | - | 3106106..3107329 (-) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| AB0R89_RS15005 (AB0R89_15005) | - | 3107459..3108925 (-) | 1467 | WP_020954301.1 | nicotinate phosphoribosyltransferase | - |
| AB0R89_RS15010 (AB0R89_15010) | - | 3108943..3109494 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| AB0R89_RS15015 (AB0R89_15015) | - | 3109591..3109989 (-) | 399 | WP_015240486.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=1019564 AB0R89_RS14990 WP_003152043.1 3105153..3105293(-) (degQ) [Bacillus velezensis strain AP45]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=1019564 AB0R89_RS14990 WP_003152043.1 3105153..3105293(-) (degQ) [Bacillus velezensis strain AP45]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |